KEGG   Ignavibacterium album: IALB_1711Help
Entry
IALB_1711         CDS       T01943                                 

Definition
Mg-chelatase-like protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ial  Ignavibacterium album
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    IALB_1711
Enzymes [BR:ial01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     IALB_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1945140..1946648
Genome map
AA seq 502 aa AA seqDB search
MNISKIRTIGDLKKSGYKTLSVKEELRKNMIEFLRQGKNPFEGIIGYDDTVIPELQTAIL
SRHNIILLGLRGQAKTRVARLFVNLLDEYIPVVEGSEINDDPFNPLSKYAKDLIKEAGDD
TKISWLHRSERYTEKLATPDVTVADLIGDVDPIKAAALKLPYSDERVIHFGLIPRSHRGI
FVINELPDLQARIQVALFNILQENDIQIRGFKIRLPLDIQFIFTANPEDYTNRGSIVTPL
KDRIDSQILTHYPKSTYISQKITEQEAQLTKEQKEKIIVPELLKQIIEQIAFEARESEYV
DEKSGVSARLTISAFENLVSFAERRRIVNNETQTTARISDLVGVIPAITGKIELVYEGEQ
EGPAKVAQILIGKAIRSVFEQYFPNPEQIKKKQANNPYSQIINWFGKGNTVDLLISMSDK
EYSEKMRGIPGLQKVVDEFQPDADEKLTLLFMEFIIYGLSEFSMLSKFRLENGIQFKDML
SSMFNMKPEDDFDIDEDSEFFK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaacattagtaaaatcagaaccatcggagatttaaagaaaagtggttacaaaacttta
tctgtaaaagaagaactcaggaaaaacatgattgaattccttcgtcaaggaaaaaatcct
tttgaaggaatcattggatatgatgatactgtaattcctgaacttcaaactgcaattctt
tcaagacataatattattttacttggtttgagaggacaggcaaaaacaagagttgcaaga
ttatttgttaatcttcttgatgaatatattcctgtagttgaaggttcggaaatcaacgat
gatccttttaatccactttcaaagtacgctaaagatttgattaaagaagctggcgacgac
acaaaaatttcgtggctgcatcgttcggaaagatacactgaaaaacttgcaactcctgat
gtaacagttgctgatttaataggtgatgttgatccaattaaagctgctgcattaaaactt
ccatactcagatgaaagagtcattcactttggactaattccaagatctcatcgtggaatt
tttgtaattaatgaattacctgatttgcaagcaagaattcaagttgcactttttaatatt
cttcaggaaaatgatattcagataagaggattcaaaatcagattgccgcttgatattcaa
tttatctttactgcaaatcccgaagattatacaaatcgaggttcgattgtaactccgttg
aaagacagaattgatagtcagattcttacacattatcctaagtcaacatatatatcgcaa
aaaattactgaacaggaagctcagttaaccaaagaacaaaaagaaaaaattattgttcct
gaattactgaaacaaattattgaacaaattgctttcgaagctcgtgaaagtgaatatgtt
gatgagaaaagcggagtatcagcaagattaacaatctctgcatttgaaaatttggttagt
tttgctgaaagaagaagaatcgtaaataatgaaactcaaacaactgcaagaatcagtgat
ttggttggagtaattcctgcaattaccggtaagattgaacttgtttacgaaggtgagcag
gaaggtccggcaaaagttgctcagatattaattggtaaggcaatccgctccgtgtttgaa
caatactttccaaacccggaacaaataaaaaagaaacaagcgaacaatccttattctcaa
ataataaattggtttggtaaaggcaatacagtcgatctattaatctcaatgtcagataaa
gaatattcggagaaaatgagaggaattccaggactgcaaaaagttgttgatgaatttcaa
ccggatgcagatgaaaaactaactttactgtttatggaatttataatttatggtttatct
gaattctcaatgttgagtaaattcagactggaaaatggcatccagttcaaagatatgtta
agttcgatgttcaatatgaaacctgaagatgattttgatattgatgaagattctgaattc
ttcaaataa

DBGET integrated database retrieval system