KEGG   Ignavibacterium album: IALB_1966Help
Entry
IALB_1966         CDS       T01943                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ial  Ignavibacterium album
Pathway
ial00010  Glycolysis / Gluconeogenesis
ial00052  Galactose metabolism
ial00500  Starch and sucrose metabolism
ial00520  Amino sugar and nucleotide sugar metabolism
ial00521  Streptomycin biosynthesis
ial01100  Metabolic pathways
ial01110  Biosynthesis of secondary metabolites
ial01120  Microbial metabolism in diverse environments
ial01130  Biosynthesis of antibiotics
ial01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IALB_1966 (glk)
   00052 Galactose metabolism
    IALB_1966 (glk)
   00500 Starch and sucrose metabolism
    IALB_1966 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    IALB_1966 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    IALB_1966 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    IALB_1966 (glk)
Enzymes [BR:ial01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     IALB_1966 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFH49672
UniProt: I0AL15
Position
complement(2255770..2256765)
Genome map
AA seq 331 aa AA seqDB search
MESNKIILAGDVGGTKTLLALYECSGSHWIELKSKKYSSTEFANLELIVKDFLESQQISP
ASAVFGIPGPVEHGVVKSTNLPWIVDEKLLSKNLHIPKVKIVNDLAATAYQIPFLKEEEK
ILIKETSNEKRSERFVVVAPGTGLGQALLICEDDKKIVLASEGGHIDFAPTNELELELLH
FLLKKFERVSYERIISGSGLPNIYDFLVESKFARSEEETIGRMKTEDRAIVISEMALAQK
DKVCEKALEIFASVLGAHSGNLVINLLATGGVYLGGGIPHKILSKLKDGVFIKSFVNKGR
LNPIVEETPVYVINNNLAALQGAARIAESLI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagtaacaaaattattttagcaggtgatgtcggtggtacaaaaactctgcttgca
ctttatgaatgcagcggaagtcactggattgaattaaaatctaaaaaatatagcagtact
gaatttgccaatctggaattaattgtcaaagattttttagaaagtcagcaaatttctccg
gcaagcgctgtatttggaattccaggaccggttgagcacggagttgtaaaatcaacaaac
cttccctggatagttgatgaaaaattactaagtaaaaatttgcacatacctaaagtaaag
attgttaacgatctcgctgcaacagcttatcaaattcctttcctgaaagaagaagaaaaa
atattaattaaagaaaccagcaatgaaaaaagaagtgaacgatttgttgttgttgcaccg
ggaacaggattgggacaggcacttctgatttgtgaagatgataaaaaaattgttctcgct
tcagaaggaggtcatatagatttcgcaccgactaacgaattagaacttgagcttctacat
tttcttcttaaaaaatttgaacgcgtgagttatgaaagaataatctcaggcagcggatta
ccaaatatttatgattttttagttgaaagtaaatttgctagatctgaggaagaaacaatc
gggagaatgaaaacagaagatagagccatagtaatttccgaaatggcgctggcacaaaaa
gataaggtttgtgagaaagcattagaaatttttgcatcggttcttggcgcacattcagga
aatttagttataaacttgcttgcaacaggcggagtttatctcggtgggggaatacctcat
aaaatattatcaaaactaaaggatggagtttttataaaaagttttgtgaataaaggaaga
ctgaatccgattgttgaagaaactccggtttatgttatcaataataatttagcagcactt
cagggagcggcaagaattgctgaaagcttgatatag

DBGET integrated database retrieval system