KEGG   Ignavibacterium album: IALB_1980Help
Entry
IALB_1980         CDS       T01943                                 

Gene name
pfk
Definition
6-Phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ial  Ignavibacterium album
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IALB_1980 (pfk)
   01230 Biosynthesis of amino acids
    IALB_1980 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IALB_1980 (pfk)
   00030 Pentose phosphate pathway
    IALB_1980 (pfk)
   00051 Fructose and mannose metabolism
    IALB_1980 (pfk)
   00052 Galactose metabolism
    IALB_1980 (pfk)
  Energy metabolism
   00680 Methane metabolism
    IALB_1980 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    IALB_1980 (pfk)
Enzymes [BR:ial01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     IALB_1980 (pfk)
Protein phosphatases and associated proteins [BR:ial01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     IALB_1980 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2271323..2272420)
Genome map
AA seq 365 aa AA seqDB search
MAKKNEIRRIGILTGGGDCPGLNAVIRGVTKPAEDYGMTVFGILDGFEGLVEGKAKELTN
QDVSGILARGGTILGSSNKGDPFHWPVEVAGKIEIQDKSQAALNNYKAWNLDALIAIGGD
GTMHICDKLSHMGMNVIGVPKTIDNDLEATDLTFGHDSAVYVVATSLDRLHTTAASHHRV
LVVEVMGRYAGWIALNGGLAGGADIILIPEIPFSWEKVYAKIKERELMGKKFSLVCVAEG
AKPLGGEIVTRGTDIKRTDPVQLGGIGKVVADKIEENTGRETRVTVLGHLQRGGSPTPFD
RILSTKFGAFAIDLVAQKKFGRMVALKGSEIKSVRIEDAISRQKLVKPDDQAVIAARRVG
ISFGD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaagaatgaaataaggagaataggaatattaaccggaggaggagattgtccc
ggacttaatgctgttatcaggggtgttacaaaacctgctgaggattatggaatgacagta
tttggcattcttgatggtttcgaaggattggtggaagggaaagctaaagaacttactaat
caggatgtttcgggaattttggcaaggggagggacaatacttggctcatcaaacaaaggc
gacccgtttcattggcctgtagaagttgctggtaagatagaaatacaggataaatcgcaa
gcagcattgaataattataaggcctggaatcttgatgctcttattgcaatcggtggtgat
ggaacgatgcacatttgtgataaactttcacatatgggtatgaatgtaatcggagtgcct
aaaactattgataatgatttggaagcaacggatttaacatttggacacgattccgcagtt
tatgtagttgcaacttctctcgacagattacacacaactgccgcatcccatcacagagta
ctggtggttgaagttatgggcagatacgcaggttggattgcactgaacggtggactcgct
ggtggtgccgatataattttaattcccgaaattcctttctcgtgggaaaaagtttatgct
aagattaaggaaagagaattaatgggtaagaagttcagtcttgtctgtgttgcagaagga
gcaaaaccacttggtggtgaaattgtaacaagaggaactgacattaaaagaactgatcct
gttcagcttggaggaattggaaaagttgtagctgataaaatagaggaaaacacaggcaga
gaaaccagagtaactgtgcttggtcatttgcagagaggtggaagtccaaccccttttgac
agaattctctctactaaatttggtgcattcgcaatagatttggttgctcagaaaaagttt
ggacgaatggttgcattaaaaggaagtgaaattaaaagcgtaagaattgaagatgctata
tcaagacaaaaactggtaaaacctgatgatcaggctgtgatagctgcccgaagagtaggc
atttcattcggagattga

DBGET integrated database retrieval system