KEGG   Ignavibacterium album: IALB_2036Help
Entry
IALB_2036         CDS       T01943                                 

Gene name
pfk
Definition
6-Phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ial  Ignavibacterium album
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IALB_2036 (pfk)
   01230 Biosynthesis of amino acids
    IALB_2036 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IALB_2036 (pfk)
   00030 Pentose phosphate pathway
    IALB_2036 (pfk)
   00051 Fructose and mannose metabolism
    IALB_2036 (pfk)
   00052 Galactose metabolism
    IALB_2036 (pfk)
  Energy metabolism
   00680 Methane metabolism
    IALB_2036 (pfk)
Enzymes [BR:ial01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     IALB_2036 (pfk)
Protein phosphatases and associated proteins [BR:ial01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     IALB_2036 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2328359..2329747)
Genome map
AA seq 462 aa AA seqDB search
MTIAPKKLAILVGGGPAPGINSVIGAATIRAAVEGIEVLGIKDGFQWIMEGDITRVKELT
IHNVSRIHFRGGSYIGISRANPTKDKKHLENTVTSLLRLNVDKLITIGGDDTAYSALKVN
EMAAGRIKVVHVPKTIDNDLDLPHGIPTFGFQTARHIGVDIVKNLMVDAQTTSRWYFVIS
MGRKAGHLALGIGKATGATITLIPEEFSGKEIKLNHIVDILVGAIIKRLSYGRPDGVAII
AEGLVEHLNPGDLEDLVTVERDAHDNIRIAEINFGEILKAKVQERLKQFGLKATIVAKNI
GYELRCADPIPFDMEYTRDLGFAASQFILSGGSGAMVSIQNGRFVPLYFNEILDPKTNRT
KVRMVDPSSESFYIARRYMLRLNQADFDDPHELAKLAATAGISIDEFRNQFYYLIENDLL
YKFIREGKIELASQDSNWAYNPPVPSRDAENELNGESMLPNL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgcacctaaaaagttagcgatacttgttggcggtggtcctgcaccgggaatt
aatagtgtaataggcgcagcaactattcgtgcagcagttgaaggtattgaagtgctcgga
attaaagacggcttccagtggataatggaaggcgatataacaagagtaaaagaattgacg
attcataatgtaagtcgtattcatttcagaggcggttcgtacataggaatttccagagcc
aatcctaccaaagataaaaaacatcttgagaatacagttacttctttactgagacttaat
gttgataagctcataacaatcggcggtgatgatacagcttacagcgccttgaaagtaaat
gaaatggctgcaggaagaattaaagttgttcatgttcccaaaacaattgataatgacctc
gatcttccgcacggaattcctactttcggatttcagactgcaagacatatcggagttgat
attgtaaaaaatctcatggttgatgctcaaacaacttcacgatggtattttgtcatttca
atgggaagaaaagccggacatcttgcactgggaattggtaaagcaacaggtgctacaatt
actctcatcccagaagagttttccggaaaagaaataaaacttaatcacatagttgacatt
cttgttggtgcaattataaaaagattaagttatggaagacctgatggtgttgcaattatt
gctgaaggattggttgaacatcttaatccaggtgatctcgaagaccttgtaacagttgaa
agagatgcccacgacaatatcagaattgctgaaattaattttggtgaaatacttaaagca
aaagttcaggaaagattaaaacaattcggattgaaagctacaatcgttgcaaagaacatt
ggttatgaattacgctgtgctgatccgattccattcgatatggaatatacaagagatctt
ggctttgccgcttcgcagtttattctcagtggcggaagtggtgcaatggtttcaattcag
aacggaaggttcgttccgctttatttcaatgaaattcttgatccgaaaaccaaccgtaca
aaagtaagaatggttgacccttcatcagaatcattttacatagcacgaagatatatgtta
agattaaatcaggcagattttgatgatccacacgaattagctaagctcgctgcaacggct
ggtatctctattgatgaattcaggaatcagttctattatctgatagaaaatgatttgcta
tacaaatttattcgtgaaggcaagatagaactggcatcacaagatagtaactgggcatat
aatccgcccgttccttcgagagatgctgagaatgaattaaacggcgaatcaatgctgcca
aatttatag

DBGET integrated database retrieval system