KEGG   Ignavibacterium album: IALB_2042Help
Entry
IALB_2042         CDS       T01943                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase
Organism
ial  Ignavibacterium album
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2336735..2337691)
Genome map
AA seq 318 aa AA seqDB search
MKTPKKVNLALTPTPLEIIKYQDKKFLIKRDDLTGCELSGNKVRKLEYILADAIRNKADI
IFTCGGEQSNHARATTIAAKKLGIPVKLFLWGSERKIPSGNLFLNKMYGAEILFLNKNDY
EKVNDIMQYQREKLSRKNINAYVIPEGGSTATGIFGYFSFITELMKQVDLNKIKGIVTAA
GSGGTSAGMLAAVSNLNLDLKIIAVNVLYPKDVITKKILMLAEAVNLEYDFNTRIKTENL
VVLDGYSEEGYKNISNNKIKLIRNFAKETAILLDPAYTGKAFVAYYENYLAKNIGMKYIF
VHTGGIFGVFGRENEYLI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaccaaaaaaagttaatctcgctttaactccaactccgttagagattatcaaa
tatcaggacaaaaagtttttaattaaacgagacgatctcactggttgtgaactttctggt
aacaaagtcagaaagcttgaatacattttagcagatgcaatcagaaataaagctgatatt
attttcacttgtggaggtgagcagtcaaaccatgcgcgtgcaacaacaattgcagcaaag
aaactcggcattccggtgaaattatttctttggggaagcgaaagaaaaattccaagcggt
aatctgtttctgaacaaaatgtacggagctgaaatattatttctgaataaaaatgattat
gagaaagtaaatgatataatgcaatatcaaagggaaaaactttcaagaaaaaatattaat
gcttatgtaattcccgaaggtggttcaactgcaaccggaatttttggctacttttcattt
attacagaactgatgaaacaagttgacctgaataaaataaaaggaatcgtaacggctgcc
ggaagtggtggcacaagcgccggaatgcttgcagcagtttctaatcttaatcttgatttg
aaaatcattgcagttaatgtcctttatcctaaagatgtaattacaaaaaagattttaatg
ctggctgaagctgttaatcttgaatatgatttcaatacaagaattaaaacagaaaatctg
gttgtgcttgatggatattctgaagaaggttataaaaatatttccaataataaaattaaa
cttattagaaattttgcgaaagaaaccgcaattctactcgatccggcttacacaggtaaa
gcattcgttgcatattatgaaaattatctcgctaaaaatattggaatgaaatacatattt
gttcatactggtggtatattcggtgtttttggaagagaaaatgaatacctgatttaa

DBGET integrated database retrieval system