KEGG   Ignavibacterium album: IALB_2078Help
Entry
IALB_2078         CDS       T01943                                 

Gene name
asnB
Definition
(GenBank) Glutamine-hydrolyzing asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ial  Ignavibacterium album
Pathway
ial00250  Alanine, aspartate and glutamate metabolism
ial01100  Metabolic pathways
ial01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IALB_2078 (asnB)
Enzymes [BR:ial01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     IALB_2078 (asnB)
Peptidases [BR:ial01002]
 Cysteine Peptidases
  Family C44
   IALB_2078 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 BLI1
Motif
Other DBs
NCBI-ProteinID: AFH49783
UniProt: I0ALC6
Position
complement(2378762..2380597)
Genome map
AA seq 611 aa AA seqDB search
MCGIFGALSLTDKFDEKDFSKFVKLTDIVSYRGPDASDYKSFDTQNKSVNKSQFDLFFGH
RRLSIIDLSDDGKQPLYSDNCWIIFNGEIFNYVELREELKSKNYNFHTNTDTEVIIKIYK
EFGERGFDKLNGMWAFALYDMQLNKLILSRDRFSIKPLFIYNQINRLFFASEIKQLIPLL
EKKELELDNMLVFLQQGILDFDEKTLFKQIYRVKAKTNLIIDFNSKQIEEKKYWDYSNEP
IEGTDKKINSMFRDLFIDSVKIRLRSDVQIGSLLSGGLDSSAITFSALNCTGNSLKTFSV
ISNQKEFSEEKYIDIITQKFNIHNKKILLDADQLKNDLDKVIEHQDEPFNYFIPVAHFNL
IKALNENSDIVVILNGQGGDETLLGYLRFYFFYWKKLLKEKEFSLLTKELFASVLNRTAI
FQFRLNVAKRYMPQKLLTKKNFLLQNHNLINVWEYNDLRTSQINDIDYYSVPFLNRYEDR
NSMAFSKEIRLPFLDHRLVDFLVNISPDKKMKNGWSKYILRKSFPELPKQIRWRRDKKGF
VLPESKWLKEDLRDSIHSMFGGKNFLSQFGLIDSNKFLEYYNDFLNGDKIIHSTDISRIF
IAEKWLEKYFN
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcttcggagcactaagtttaactgataaattcgatgaaaaagattttagc
aagtttgttaaactcaccgatatcgtttcttatcgcggacctgatgcatccgattataaa
agttttgatacacaaaataaatctgtaaataaatctcagttcgaccttttctttgggcac
agaagactttcaattatagatttgagtgacgatggaaagcaacctctgtacagcgataat
tgctggataatttttaacggagaaatttttaattatgtcgagcttcgcgaagaacttaaa
tcaaaaaactataactttcacaccaacacagacacggaagtaataataaaaatttataaa
gaatttggtgaaagaggttttgataaacttaatggtatgtgggcttttgctctttatgat
atgcaattgaataaacttattctatctcgtgacagattttcaattaaacctcttttcatt
tataaccaaattaataggttattttttgcaagtgaaattaaacaactaattccacttctt
gaaaagaaagaattagaacttgataatatgctggtatttcttcagcagggtatattggac
tttgatgagaaaactttatttaaacagatctatagagtaaaagctaaaaccaatttgata
attgattttaattcaaaacaaatcgaagaaaaaaaatattgggattattcaaatgaacca
attgaaggaaccgataaaaaaattaactcaatgttcagagacctattcattgactctgtg
aagataagattacgaagtgatgttcagattggttctttgttaagtggaggacttgattct
tctgccattactttttctgcgctcaattgcacaggtaattcgttaaaaacattctctgtt
ataagcaatcaaaaagaattttctgaagaaaagtatatagatattatcactcaaaaattt
aatatccacaataaaaaaattttgctagatgctgaccaactaaaaaatgatttagataaa
gttatcgagcatcaggatgaaccattcaactatttcattcctgtggcacattttaatctg
ataaaagcattaaatgaaaactcagatatagttgtcatccttaatggtcaaggtggagat
gagactttacttggttatctgagattttatttcttttattggaagaaacttttaaaggaa
aaagaattttctcttttaactaaagaattatttgcatctgtgttaaaccggacagcaatt
tttcagtttcgtttgaatgtagcaaaaagatatatgcctcaaaaattattaactaaaaag
aattttctcttacaaaaccataatctcataaatgtgtgggaatataatgatcttagaact
tcacaaattaatgatattgattattattcagtccctttcttaaataggtatgaagacaga
aattcaatggcattttcaaaggaaataagattaccgtttttagatcacagattggttgat
tttcttgttaatatttcgcctgataagaaaatgaaaaatggttggagcaaatacatacta
agaaaatcatttccagaattaccaaaacaaattcgatggagacgagataaaaaaggattc
gttcttccggaatcgaaatggttaaaagaagatttacgagactctattcattcaatgttc
ggtggaaaaaattttttgagtcaattcggtttgatagattcaaataaatttttagaatac
tataatgattttttaaatggagataaaattattcattcaacggatatctccaggatattt
attgcagaaaaatggttagaaaaatatttcaattag

DBGET integrated database retrieval system