KEGG   Ignavibacterium album: IALB_2391Help
Entry
IALB_2391         CDS       T01943                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ial  Ignavibacterium album
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ial01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ial00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2720452..2721246
Genome map
AA seq 264 aa AA seqDB search
MNILEEIVEVKKEEVKNLKKKYSFNSFNSMEYFQSQSRSFKKTVSNQKKISIIAEVKKAS
PSKGIIQNNFNHIRISEAYQSAGADAISVLTDEKFFKGHLNFLSDIRKQTNIPLLRKDFL
IDEYQILEAKAFGADAILLISEILSINQIKDLTDCAIENNLDVLLELHSENEISKIDFNR
NDLIGINNRDLKTFEVDLTTTERVLKKIDKQITSVSESGISKRDDIEYLKSINVNAILVG
EHFMRSENPADELKQFTEWCRYEN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcttgaagaaattgttgaggtcaaaaaagaagaagtaaaaaatcttaaaaag
aaatattcttttaactcatttaactcaatggaatattttcagagtcagtcgagaagtttt
aaaaaaactgtatctaatcaaaagaaaatttctatcattgctgaagtaaaaaaagcaagt
ccatcaaaaggtatcatacaaaataatttcaatcatatcagaatatcagaagcatatcaa
tcagccggtgctgatgcaatatcagttcttaccgatgaaaaattttttaagggacactta
aattttctctctgatatcagaaagcaaacaaatattcctttactcagaaaagattttctg
attgatgaatatcaaattcttgaagccaaagcatttggtgctgatgcaattcttttaatc
agcgaaatactttctataaatcagataaaagatttaactgattgtgcaatagaaaataat
cttgatgtattgctcgagcttcattcagaaaatgaaatttcaaagattgattttaacaga
aatgatttaattggaattaataaccgtgatttgaaaacttttgaagttgatttgacaaca
actgaaagagttcttaagaaaattgataagcaaattacttctgtttctgaaagtggaatc
agtaaaagagatgacattgaataccttaaatcaattaatgttaatgcaattcttgtagga
gaacattttatgcgatcagaaaatccggcagacgaacttaaacaatttactgaatggtgc
agatatgaaaattaa

DBGET integrated database retrieval system