KEGG   Ignavibacterium album: IALB_2391Help
Entry
IALB_2391         CDS       T01943                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ial  Ignavibacterium album
Pathway
ial00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ial01100  Metabolic pathways
ial01110  Biosynthesis of secondary metabolites
ial01130  Biosynthesis of antibiotics
ial01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    IALB_2391 (trpC)
Enzymes [BR:ial01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     IALB_2391 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C Amidase_3
Motif
Other DBs
NCBI-ProteinID: AFH50094
UniProt: I0AM87
Position
2720452..2721246
Genome map
AA seq 264 aa AA seqDB search
MNILEEIVEVKKEEVKNLKKKYSFNSFNSMEYFQSQSRSFKKTVSNQKKISIIAEVKKAS
PSKGIIQNNFNHIRISEAYQSAGADAISVLTDEKFFKGHLNFLSDIRKQTNIPLLRKDFL
IDEYQILEAKAFGADAILLISEILSINQIKDLTDCAIENNLDVLLELHSENEISKIDFNR
NDLIGINNRDLKTFEVDLTTTERVLKKIDKQITSVSESGISKRDDIEYLKSINVNAILVG
EHFMRSENPADELKQFTEWCRYEN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcttgaagaaattgttgaggtcaaaaaagaagaagtaaaaaatcttaaaaag
aaatattcttttaactcatttaactcaatggaatattttcagagtcagtcgagaagtttt
aaaaaaactgtatctaatcaaaagaaaatttctatcattgctgaagtaaaaaaagcaagt
ccatcaaaaggtatcatacaaaataatttcaatcatatcagaatatcagaagcatatcaa
tcagccggtgctgatgcaatatcagttcttaccgatgaaaaattttttaagggacactta
aattttctctctgatatcagaaagcaaacaaatattcctttactcagaaaagattttctg
attgatgaatatcaaattcttgaagccaaagcatttggtgctgatgcaattcttttaatc
agcgaaatactttctataaatcagataaaagatttaactgattgtgcaatagaaaataat
cttgatgtattgctcgagcttcattcagaaaatgaaatttcaaagattgattttaacaga
aatgatttaattggaattaataaccgtgatttgaaaacttttgaagttgatttgacaaca
actgaaagagttcttaagaaaattgataagcaaattacttctgtttctgaaagtggaatc
agtaaaagagatgacattgaataccttaaatcaattaatgttaatgcaattcttgtagga
gaacattttatgcgatcagaaaatccggcagacgaacttaaacaatttactgaatggtgc
agatatgaaaattaa

DBGET integrated database retrieval system