KEGG   Ignavibacterium album: IALB_2394Help
Entry
IALB_2394         CDS       T01943                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ial  Ignavibacterium album
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    IALB_2394 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IALB_2394 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    IALB_2394 (trpB)
Enzymes [BR:ial01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     IALB_2394 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2722870..2724063
Genome map
AA seq 397 aa AA seqDB search
MIKTAYNQPDSKGKFGRFGGKFVPETLITPLQQLEEAYLNLKDDKSFNDELNYLNIEFTG
RPTPLTFAERLTKHFSKAKIYLKREDLCHTGAHKINNVLGQILLAKHLDKKRIIAETGAG
QHGVATATACAKFGLQCFVYMGETDIERQKPNVFRMKLMGAEVVPVKSGSRTLKDATNEA
IRDWVTNVEDTHYIIGSVVGPHPYPMIVRDFQSIIGKETRKQIIEKENRLPDYLLACVGG
GSNAIGMFFPFINDVNVKKIGIEAAGKGLDTDEHCATLTKGRDGIFQGMKTYLLQDEAGQ
VREVYSISAGLDYPGVGPEHSFLKEENLVEYYSITDKEAIEAVKLLSRTEGIIPALETAH
AIAYLKYLMPKTTEDEIVIINLSGRGDKDLNTIMEFL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaacagcttacaatcaacctgattccaaaggaaagtttggaagatttggtgga
aagtttgttcccgaaactttaattacaccgcttcaacagcttgaagaagcttatctgaac
ttaaaagatgataagagctttaatgacgaactgaattatttaaatatagaatttacaggc
agaccaactcctttgacttttgcagagcgattgacaaaacatttcagcaaagcaaaaatt
tatctgaaaagagaagacctttgtcatacaggcgcacataaaataaacaatgttttggga
caaatacttcttgcaaaacatcttgacaaaaaaagaattattgcggaaacaggcgcaggt
caacacggagttgcaacagcaactgcctgcgcaaagtttggtctgcaatgctttgtttat
atgggtgaaacggacatcgaaagacagaaaccaaatgtcttcagaatgaagttgatgggt
gctgaagtagttcctgttaaatcaggaagcagaactttgaaagatgcaaccaacgaagca
atcagagattgggttacaaatgttgaagatacgcattacataattggttcggttgtagga
ccgcatccttatccaatgattgtgcgagattttcaatcaataatcggaaaagaaacgcgc
aaacaaattattgaaaaagaaaatcgtttacccgattatctgcttgcttgcgttggtggc
ggaagtaatgcaatcggaatgttctttccattcatcaatgatgtgaatgttaaaaaaatt
ggtattgaagctgcaggtaaaggtttagatactgatgagcattgtgcaactttaacaaaa
ggtcgtgatggaatttttcagggaatgaaaacttatttacttcaggacgaagctggtcag
gttcgtgaagtttattctatatcagccggacttgattatccgggcgttggtcctgaacat
agctttctgaaagaagaaaatcttgtggaatattattcaatcactgacaaagaagctatt
gaagcagtaaaactactttctcgaactgaagggattattcccgctctcgaaaccgcacat
gcaattgcctacttaaaatatcttatgccgaaaaccacagaagatgaaatcgtaattata
aatcttagcggaagaggtgataaagatttaaatactataatggaattcttatga

DBGET integrated database retrieval system