KEGG   Ignavibacterium album: IALB_2395Help
Entry
IALB_2395         CDS       T01943                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ial  Ignavibacterium album
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    IALB_2395 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IALB_2395 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    IALB_2395 (trpA)
Enzymes [BR:ial01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     IALB_2395 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2724060..2724842
Genome map
AA seq 260 aa AA seqDB search
MSKIESTIKNEISNGRKVLSAFLTAGFPVVDGFSDLVLKTFESGADIIELGIPFSDPIAD
GPVIQHSSQVAIENGITLEKVFLIVSEIRKHSDKPIILMGYANPILKFGVTSFFSACNEL
KVDGLIIPDIPLEEYDSFFDTSVKNIDTILLISPTSDNNRIKLIGEKSRGFVYCVSIKGI
TGERNSVSQESLDYIRKVKKILPDKNILVGFGISNPQIAKRFATISDGVIVGSAAIKLLK
EKKYKEMNQLVRSIKSELSF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatagaatcaactattaaaaatgaaatttcgaatggaagaaaagttctttca
gcttttctgactgcaggatttcctgttgttgatggattttcagatttggttttaaagaca
tttgaatccggtgcagatataatcgaattaggaattccattcagcgatccaattgctgat
ggtccggttatacaacattcatctcaggttgctattgagaacgggattactttagaaaaa
gtttttctcatcgtgagtgaaatcagaaaacactctgataaaccaattattctgatgggt
tatgcgaatccgattttaaaatttggtgttacttcatttttttcagcttgcaatgaatta
aaagttgatggtttgattattcctgatattccattagaagaatatgattcattctttgat
acttctgtaaaaaacattgatacaattttgttaattagtccaacatcagataataacaga
attaaattaatcggagaaaaatcgagaggatttgtttactgcgtgagcattaaaggcata
acaggagaaagaaactcagtttctcaggaaagcttagactacatcagaaaagtaaaaaag
attttgcccgacaagaacatcttggtcggatttgggatttctaatccgcagatagcaaag
cgtttcgcaactatatcggatggagtaattgtcggaagtgcggcaataaaattactaaaa
gaaaaaaaatataaagagatgaatcaactggtcagatcaattaaaagtgagttgagtttt
taa

DBGET integrated database retrieval system