KEGG   Ignavibacterium album: IALB_2592Help
Entry
IALB_2592         CDS       T01943                                 

Definition
transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ial  Ignavibacterium album
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IALB_2592
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IALB_2592
   00052 Galactose metabolism
    IALB_2592
   00500 Starch and sucrose metabolism
    IALB_2592
   00520 Amino sugar and nucleotide sugar metabolism
    IALB_2592
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    IALB_2592
   00524 Butirosin and neomycin biosynthesis
    IALB_2592
Enzymes [BR:ial01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     IALB_2592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2962348..2963325
Genome map
AA seq 325 aa AA seqDB search
MNKTKLVLGVDVGGTNTVFGLVDKTGNVFLIDSIPTHGDKSAEDLFKRLFEKFYQVSEDA
KEDFELAGIGIGAPNANYYKGTVENPPNLNWEYVDIISLIKKFSDAPVALTNDANAAALG
EMYYGAAKGMKDLIVITLGTGLGSGIVVNGNLVYGHDGFAGEIGHTIYDPQGRQCGCGRK
GCLETYASAPGIKRTVMELIANTNFKSKLRSVSYESLDAKFITELALQGDKIALEAFDFT
AKVLGIKLADAIAHTSPEAIILFGGLANAGDLLLVPTKKYLEENVFHVFRNKVKILKSEL
NEGKSAVLGAAALIWHELNTMVINQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacaaaattagtgcttggtgttgatgttggtggcactaacactgttttcggt
cttgttgataaaaccggaaatgtttttctgattgactcaattccaactcacggagataag
tcagcagaagatttattcaaaagactatttgaaaaattttatcaagtttccgaagatgca
aaagaagattttgaattagccggaataggtataggtgctccaaatgcaaactattataaa
ggaactgtagagaatccaccaaaccttaattgggaatatgtggatattatttcactgata
aaaaaattttcagatgcgcctgttgccttaacaaacgatgcaaatgctgctgctctcggc
gaaatgtattacggagcagctaaaggaatgaaagatttaatcgtaataactttgggaact
ggcttaggaagtggaattgttgttaacggaaatttagtttatggtcacgatggttttgcc
ggagaaatcggacacacaatttacgatcctcagggaagacagtgtggttgcggaagaaaa
ggttgtcttgaaacttatgcatcggcacctggaattaaaagaaccgtgatggaacttatt
gcaaatactaattttaagagcaaacttcgttcggttagttatgaaagtctggatgcgaaa
tttattactgaacttgctttgcaaggtgataaaatagcacttgaagcttttgatttcaca
gctaaagttcttggtataaaactcgctgatgcaattgcacacacaagccccgaagcaatc
attcttttcggtggacttgcaaacgcaggcgatttacttttggttccgacaaaaaaatac
ctcgaagaaaatgtttttcatgttttcagaaataaagttaagatactaaagtctgagcta
aacgaaggaaaatccgctgtacttggtgcagcagcattaatatggcacgagcttaacaca
atggtaataaaccaataa

DBGET integrated database retrieval system