KEGG   Ignavibacterium album: IALB_2592Help
Entry
IALB_2592         CDS       T01943                                 

Definition
(GenBank) Transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ial  Ignavibacterium album
Pathway
ial00010  Glycolysis / Gluconeogenesis
ial00052  Galactose metabolism
ial00500  Starch and sucrose metabolism
ial00520  Amino sugar and nucleotide sugar metabolism
ial00521  Streptomycin biosynthesis
ial01100  Metabolic pathways
ial01110  Biosynthesis of secondary metabolites
ial01120  Microbial metabolism in diverse environments
ial01130  Biosynthesis of antibiotics
ial01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IALB_2592
   00052 Galactose metabolism
    IALB_2592
   00500 Starch and sucrose metabolism
    IALB_2592
   00520 Amino sugar and nucleotide sugar metabolism
    IALB_2592
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    IALB_2592
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    IALB_2592
Enzymes [BR:ial01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     IALB_2592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFH50295
UniProt: I0AMT8
Position
2962348..2963325
Genome map
AA seq 325 aa AA seqDB search
MNKTKLVLGVDVGGTNTVFGLVDKTGNVFLIDSIPTHGDKSAEDLFKRLFEKFYQVSEDA
KEDFELAGIGIGAPNANYYKGTVENPPNLNWEYVDIISLIKKFSDAPVALTNDANAAALG
EMYYGAAKGMKDLIVITLGTGLGSGIVVNGNLVYGHDGFAGEIGHTIYDPQGRQCGCGRK
GCLETYASAPGIKRTVMELIANTNFKSKLRSVSYESLDAKFITELALQGDKIALEAFDFT
AKVLGIKLADAIAHTSPEAIILFGGLANAGDLLLVPTKKYLEENVFHVFRNKVKILKSEL
NEGKSAVLGAAALIWHELNTMVINQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacaaaattagtgcttggtgttgatgttggtggcactaacactgttttcggt
cttgttgataaaaccggaaatgtttttctgattgactcaattccaactcacggagataag
tcagcagaagatttattcaaaagactatttgaaaaattttatcaagtttccgaagatgca
aaagaagattttgaattagccggaataggtataggtgctccaaatgcaaactattataaa
ggaactgtagagaatccaccaaaccttaattgggaatatgtggatattatttcactgata
aaaaaattttcagatgcgcctgttgccttaacaaacgatgcaaatgctgctgctctcggc
gaaatgtattacggagcagctaaaggaatgaaagatttaatcgtaataactttgggaact
ggcttaggaagtggaattgttgttaacggaaatttagtttatggtcacgatggttttgcc
ggagaaatcggacacacaatttacgatcctcagggaagacagtgtggttgcggaagaaaa
ggttgtcttgaaacttatgcatcggcacctggaattaaaagaaccgtgatggaacttatt
gcaaatactaattttaagagcaaacttcgttcggttagttatgaaagtctggatgcgaaa
tttattactgaacttgctttgcaaggtgataaaatagcacttgaagcttttgatttcaca
gctaaagttcttggtataaaactcgctgatgcaattgcacacacaagccccgaagcaatc
attcttttcggtggacttgcaaacgcaggcgatttacttttggttccgacaaaaaaatac
ctcgaagaaaatgtttttcatgttttcagaaataaagttaagatactaaagtctgagcta
aacgaaggaaaatccgctgtacttggtgcagcagcattaatatggcacgagcttaacaca
atggtaataaaccaataa

DBGET integrated database retrieval system