KEGG   Ignavibacterium album: IALB_2596Help
Entry
IALB_2596         CDS       T01943                                 

Definition
cellodextrinase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ial  Ignavibacterium album
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ial00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2969080..2971074
Genome map
AA seq 664 aa AA seqDB search
MKRLTIKVLVPTILICIKINAQIFINQTGYKNDLQKIFYTNISATNFEVVESETGNTFYN
GNLQLISSNDPATGMAIRKGDFTSLNRNGNYFIRLNSSDTSYHFTIGENVIEDLYLKSLK
SFYFQRCGTQLLYTHAGQYQRNICHTGDAFFHSSTGQSGFKYSRGGWHDAGDYGKYIVNA
GISAATLLMAYEYFPSYFSYDNLNIPESGNGIPDILDEVKYEVQWFLTMQDTSGAVFFKL
TKEQFEPFVMPSQDSGMRYIYEKSSAATADFIAVLARFYRVYKNYDSTFANTCLTSAINA
WNWLSNQLTIVPAGGFHNPPGTYTGEYGDNNDSDERLWAAAELFEATGDQSFKEYYEFNY
NASGLFNSTMNWQNVKSLAHITYLYSNRQNSDPIIKTQLAASLDSYCNSLLTKVNANGFG
VTLNPGDYYWGSNSQVLNNGVLLLLSYSKNNNINFLNAALEQLNYVTGSNAHNLSFITGT
GKKSPLHPHHRPSEADGISEPIPGLIVGGPNQYLNDPVLQQHFNQNTPPALCYIDDVGSY
ASNEIAINWNAPLVFVSGYFSNLLINSVEGEKQFSPQGFYLEQNFPNPFNSATRINWYSQ
QNGWQKIKLYDSLGRELQTIAEGFYNAGFHSLLFSMDSSIPSGVYYYQLRTDNSVLSKKM
IYLK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtttaacaataaaagttttagtacccactattcttatctgcataaaaatcaat
gcacagatttttatcaatcaaacaggatataaaaacgatttacaaaaaattttttataca
aatatttctgcaacaaattttgaggttgttgaatcagaaacaggcaacactttttataat
ggaaatcttcagttaatcagttcgaatgatcctgcaacaggaatggccatcagaaaaggt
gattttacttcattaaacaggaatggaaattattttataagactaaattcaagtgataca
tcatatcattttacaattggtgaaaatgtaatcgaagatctttatctcaaatctttaaag
tctttttactttcaaagatgtggaacgcaattattatatacacatgctggacaatatcag
agaaatatctgccacacaggtgatgcattttttcattcatcaacaggacaaagcggcttt
aaatattcacgaggtggctggcacgatgcaggtgattatggcaagtacattgtcaacgct
ggcataagtgctgccactttactgatggcttatgaatactttccttcctatttcagttat
gataatttaaatattccggaaagtggtaacggaattcccgatatccttgatgaagtgaaa
tatgaagttcaatggtttctgacaatgcaggatacaagcggtgctgtattctttaaatta
acaaaggaacagttcgaaccatttgtaatgccttctcaggattccggaatgagatatatt
tatgaaaaatcttctgctgcaacagctgactttattgctgtgttagcacgcttttacaga
gtttacaaaaattatgattcaacatttgcaaatacctgtctgacttcagcaattaatgct
tggaattggttatcaaatcagttaacaattgttcccgctggtggattccataatcctccg
ggaacatatacaggagaatacggagataataatgattcagatgagcgattatgggcagca
gcagaactattcgaagcaaccggcgatcagagttttaaagaatattatgaattcaattac
aacgcttccggcttgtttaattcaacaatgaactggcagaatgtaaaatcacttgctcac
ataacttatctatattccaaccggcaaaattccgatccgattattaaaactcagttagct
gcttcattagattcatattgtaattctcttctgacaaaagttaatgcaaacggtttcgga
gtaacattaaatccaggtgattattattggggttcaaattcacaagtacttaataatggg
gttttgttgcttctttcttactctaaaaacaataacataaattttctgaatgccgcttta
gagcagttaaattatgtgacaggttctaatgcacataacttatcttttattaccggtaca
ggaaagaaatcaccattacatccacatcatcgtccctctgaagctgatggaatttcagaa
ccaataccgggtttgattgttggcggaccaaaccaatatctgaatgatcctgttttacaa
cagcatttcaatcagaacactccaccagccttatgttatattgatgatgtgggaagttat
gcttcaaatgaaattgctataaactggaacgcacctcttgtttttgtttcaggatatttc
agcaatctgttaataaattctgttgagggtgaaaaacaattttcaccgcagggattttat
cttgaacaaaatttcccaaatccatttaattctgcgacaagaataaattggtactcacaa
caaaatggttggcaaaaaataaaactttatgattcactcggaagagaattacaaacaata
gcggaaggattttataatgccggattccattcactattattctcaatggatagttcaatt
ccgagtggtgtgtattattatcagttaaggactgacaattccgtactctcaaagaaaatg
atttatcttaagtaa

DBGET integrated database retrieval system