KEGG   Ignavibacterium album: IALB_2858Help
Entry
IALB_2858         CDS       T01943                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ial  Ignavibacterium album
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    IALB_2858
  Metabolism of other amino acids
   00480 Glutathione metabolism
    IALB_2858
Enzymes [BR:ial01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     IALB_2858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3252080..3252649
Genome map
AA seq 189 aa AA seqDB search
MKAFIAVLSIFIMLVSPAQSQNQKGVKVKDNVLSVKVKDIDGKEVNLSDYKDKVLLIVNV
ASFCGYTKQYAGLQDLYETYKDKGFEILAFPCNQFGNQEPGSNEEIKNFCSSKYNVTFRL
FDKIDVNGNNKSPLYAILTDNPVTGKGDIKWNFEKFVVGKNGKIIARFPSSVEPTSEKIV
SLIEKELKK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttatagcggtattatcaatttttataatgttagtatcaccagcacaatca
caaaatcaaaaaggagtaaaagtgaaagacaatgttctatccgttaaggtaaaagatatt
gacggaaaggaagtaaacctatctgattataaagataaagttttattgatagttaatgtt
gcaagtttctgtggttatacaaagcaatatgcgggcttgcaggatttatatgaaacttat
aaggacaaaggatttgaaattcttgctttcccctgcaatcagtttggtaatcaggaacct
ggttcaaatgaagagataaaaaatttctgttcgtcaaaatacaatgtaactttcaggttg
tttgataaaattgatgtcaacggaaacaacaaatcaccgctttacgcaatacttacagat
aatccggttaccggtaaaggcgatatcaaatggaattttgaaaaatttgttgttggtaag
aatggtaaaattatagcgagattcccaagttcagttgagccaacaagtgaaaagatagtt
tcattgattgaaaaggaattaaagaaataa

DBGET integrated database retrieval system