KEGG   Ignavibacterium album: IALB_3100Help
Entry
IALB_3100         CDS       T01943                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ial  Ignavibacterium album
Pathway
ial00010  Glycolysis / Gluconeogenesis
ial00051  Fructose and mannose metabolism
ial00562  Inositol phosphate metabolism
ial01100  Metabolic pathways
ial01110  Biosynthesis of secondary metabolites
ial01120  Microbial metabolism in diverse environments
ial01130  Biosynthesis of antibiotics
ial01200  Carbon metabolism
ial01230  Biosynthesis of amino acids
Module
ial_M00002  Glycolysis, core module involving three-carbon compounds
ial_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IALB_3100 (tpiA)
   00051 Fructose and mannose metabolism
    IALB_3100 (tpiA)
   00562 Inositol phosphate metabolism
    IALB_3100 (tpiA)
Enzymes [BR:ial01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     IALB_3100 (tpiA)
Exosome [BR:ial04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   IALB_3100 (tpiA)
  Exosomal proteins of bladder cancer cells
   IALB_3100 (tpiA)
  Exosomal proteins of melanoma cells
   IALB_3100 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Glyco_hydr_30_2 CO_dh VWA
Motif
Other DBs
NCBI-ProteinID: AFH50803
UniProt: I0AP96
Position
complement(3521191..3521946)
Genome map
AA seq 251 aa AA seqDB search
MRRKVIAGNWKMNNDLQQSVSLIEELKNKLENKSLNCDVIICPPFTSLYEAKKLIDGSAI
KLGAQNMFYEDSGAYTGEISAQMLKSVGCEYVILGHSERRTIFGERDEVINKKIKKALSQ
KLKPIFCVGETLEEREKDITEKVIKKQIEKGLVDVTPDEVLDVIIAYEPVWAIGTGRTAT
PQQAQEVHNFIRKLLANMYSKDFANMIVIQYGGSVKPENAGELLSQKDIDGALVGGACLK
AESFLGIIEAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaaaagttatagccggcaactggaagatgaataatgatcttcaacagtctgtc
tctttaattgaagaattaaaaaacaaacttgaaaataagtcattaaactgtgatgtaatt
atttgtccgccattcacatcactttatgaagcaaaaaaattaatcgatggcagtgcaatc
aaacttggtgcgcaaaatatgttttatgaagattcaggtgcatatacaggagaaatatct
gcacaaatgcttaagtcagtaggttgtgaatatgtgatacttggacactcggaaaggcga
acaatttttggtgaaagggatgaagtgattaacaagaaaataaaaaaagctttgtcgcaa
aaactaaaaccaattttctgtgtcggtgaaactcttgaagagcgcgaaaaagatataacc
gaaaaagtcataaagaaacaaattgaaaaaggattagttgatgttacacctgatgaagtt
cttgatgtaatcattgcatacgaacctgtttgggcaattggaacaggaagaacagctact
ccgcagcaagcacaggaagttcataattttatccgtaaacttcttgctaacatgtattca
aaagattttgcaaatatgatagttattcaatatggcggcagcgttaaacctgagaatgcc
ggggaattactttcacaaaaggatattgatggagctttagttggaggagcttgtcttaaa
gcagagtcatttctgggaattattgaagcagcataa

DBGET integrated database retrieval system