KEGG   Ignavibacterium album: IALB_3183Help
Entry
IALB_3183         CDS       T01943                                 

Gene name
hex
Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ial  Ignavibacterium album
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    IALB_3183 (hex)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    IALB_3183 (hex)
Enzymes [BR:ial01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     IALB_3183 (hex)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3628347..3630566
Genome map
AA seq 739 aa AA seqDB search
MKKLISLLTIIFIFNSSAQINIIPKPQVFTQSEGNFIISSQTKVYYQKESESIGKYLSEY
FKSEYGFDLSSSSNDENNQIKLVLRKVENIENNPEGYHLLITKRNILIEANNNRGLFYGV
QTLKQLQPIKSDKQSEIKIPVVEIYDFPKFKWRGLNLDCCRHFLTKEFIKRYIDLLAFQK
MNVLHWHLTEDQGWRIEIKKYPELTKVGAFRKYDDGTVYGGYYTQDDIKEIVNYAQSRYI
TVVPEIEMPGHSTAAIATYPQLSCAGGPFEVGTLWGIYKDIYCAGNEETFRFIEDVLTEV
VELFPSKYIHIGGDEAPKDRWQNCPKCQQRIKDEGLADEHELQSYFIKRVENFLNSKGKE
IIGWDEILEGGLAPGATVQSWRGTKGAIDAAKMNHDVIVSPTSHCYFDYPIETTDVPKVY
SFNPIPDELSNEEAKHVLGSEGNMWTEYAPQDLIDYRLFPRLTALAEVLWTYPNERNYEE
FASRLQKFYDKLDAMNVNYTYEISPLTFSEKFDLGKNQFEIEIGINQKGLKLYYTSDGTE
PTFKSNEYSGKLIFNKSTELKIGLFRNSKKVGETIEKFYSISKSNNKTVTLTNAASTRFE
GGSSSILTDGVRGGNNYRIGSYLGFQSTDFEATIDLETVTDINKITTGFFTASSSLVLLP
EYVEYFVSEDGVNFISLGKVTQNFSIKDPFWKRIDFSIDINKSKARYIKIFAKNQMSVPE
WHPAFGGKVWLMVDEIIVD
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaatttctttactaaccatcatttttatctttaactcatcagcacaaata
aatattattcccaaaccacaggtgttcacacaatcagaagggaattttattattagctca
caaactaaagtttattatcagaaagagtctgaatctattgggaaatacctttcagagtac
ttcaagtcggagtacggttttgatttatcatcatcgagcaatgatgaaaataatcagatt
aaactagttctcagaaaagttgaaaatattgaaaacaatccggaaggatatcatctgcta
attacaaaaagaaatattcttattgaagctaataacaatcgtgggttgttttatggagta
caaacattaaagcaattacaacccattaaatcagataagcaaagcgaaataaaaattcct
gtcgtagaaatttacgattttccgaaattcaaatggcgcggattaaatcttgattgttgc
cgtcattttctgactaaagaatttatcaaacgatatattgatttactcgcatttcaaaaa
atgaatgtgttgcactggcacttaacagaagatcagggttggagaattgaaataaaaaaa
tatccggaattaactaaagttggtgctttcagaaaatatgatgacggaactgtttatggt
ggttattacacacaggacgatataaaagaaattgtaaactatgctcaaagccgatatata
actgttgtacctgaaattgaaatgcccggacattcaacagcagcaattgcaacttatcct
caactatcctgcgctggtggtccttttgaagttggaactttgtggggaatttacaaagac
atatactgtgccggtaacgaagaaacattcagatttatagaggatgtacttacggaagta
gttgagctgtttccatcaaagtatattcacattggtggagatgaagcaccaaaagacaga
tggcagaattgtccgaagtgtcagcagagaataaaagatgaagggcttgcagacgaacac
gaactgcaaagctattttataaagcgagttgaaaattttcttaactctaaaggaaaagaa
ataattggctgggatgaaatacttgagggtggattagctcccggcgcaactgttcaatca
tggcgcggaacgaaaggcgcaattgatgcagctaaaatgaatcacgatgtgattgtctct
ccaacaagtcattgctatttcgattatccgattgaaactactgatgttccaaaagtctat
tcattcaatccgattcccgatgaacttagcaatgaagaagcaaaacatgttctcggaagc
gaaggtaatatgtggaccgaatacgctccacaagatctgattgattacagattattccca
agacttaccgctcttgcagaagtgctatggacttatcctaatgaaagaaactatgaagag
tttgcgagtcggcttcaaaaattttatgataagcttgatgcaatgaatgttaattacact
tatgaaatttctcctcttactttttcagaaaaatttgatttgggaaagaatcagtttgaa
attgaaattggaataaatcagaaaggacttaaattatactatacttctgatggaacagaa
cctacatttaaatcaaatgagtattccggaaaattgattttcaacaagagcacagaatta
aaaataggtttgttcagaaactctaaaaaagttggcgagacaattgaaaaattttactca
atatctaaatcgaataataaaacagtaactcttacaaatgcagcttcaaccagatttgaa
ggaggaagctcttcaattcttacagatggagttagaggtggaaataattacagaattggc
agttatcttggctttcaatcaacagatttcgaagccactattgatttagaaactgttaca
gatattaataaaattacaaccggatttttcacagcgtcatcatcgcttgttcttttaccc
gaatatgttgagtactttgtttccgaagatggagtcaactttatttcacttggtaaagta
acacaaaatttttcaataaaagatcctttctggaaacgaatagatttttcaattgatatt
aataaaagcaaagctcggtacataaaaatctttgcaaagaatcaaatgtcagttccagaa
tggcatccggcttttggtggaaaagtctggttaatggtcgatgagataatagtggattag

DBGET integrated database retrieval system