KEGG   Intrasporangium calvum: Intca_0246Help
Entry
Intca_0246        CDS       T01385                                 

Definition
pyrophosphate-dependent phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ica  Intrasporangium calvum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Intca_0246
   01230 Biosynthesis of amino acids
    Intca_0246
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Intca_0246
   00030 Pentose phosphate pathway
    Intca_0246
   00051 Fructose and mannose metabolism
    Intca_0246
   00052 Galactose metabolism
    Intca_0246
  Energy metabolism
   00680 Methane metabolism
    Intca_0246
Enzymes [BR:ica01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Intca_0246
Protein phosphatases and associated proteins [BR:ica01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Intca_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(265498..266586)
Genome map
AA seq 362 aa AA seqDB search
MRIGILTGGGDCPGLNAVIRGAVRAAEVTYDSTVVGFRNAWRGVMDNDFELLDVDRCRGI
LPLGGTILGTSRDQPFAFEDGLKKVRKAYDRHGLDAIIGVGGEGSMSVLARLHENGFPIV
GVPKTIDNDISLTEMTFGFQTAVQICTDAIDRLHTTAESHHRVLVVEVMGRHVGHIATWS
GIAGGAAITLVPEEPFDIGEVCERIVHRHRKGRFATIIVVAEGALPQPGTMELPEPEMDK
YGHQILGGIGSILAREIQGRTGIESRMTALGHIQRGGSPVAFDRVLGTRFGVAAVEAALD
GAWGQMVALQQGHIVRVPISDAVGQLKMVDADLLRLNTMFQPRIPGDEYPGIPADRLERV
ED
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggcatcctcaccgggggcggggactgtcccggcctcaatgcggtcatccgg
ggcgcggtccgcgccgccgaggtgacctacgacagcactgtcgtcggcttccgcaacgcc
tggcgcggggtcatggacaacgacttcgagctgctcgacgtcgaccgctgccgcgggatc
ctgcccctcggcggcaccatcctcgggacgagccgcgaccagcccttcgccttcgaggac
ggcctcaagaaggtccgcaaggcctacgaccggcacggcctcgacgcgatcatcggggtc
ggcggcgagggctcgatgagcgtcctcgcccgtctccacgagaacggcttccccatcgtc
ggcgtccccaagacgatcgacaacgacatctccctcaccgagatgaccttcggcttccag
accgccgtgcagatctgcaccgacgccatcgaccggctccacacgaccgcggagtcgcac
caccgggtcctcgtcgtcgaggtgatgggccggcacgtcggccacatcgccacgtggtcc
ggcatcgccggtggcgcggcgatcaccctagtgccggaagagcccttcgacatcggcgag
gtctgcgagcgcatcgtccaccggcaccgcaagggccgcttcgcgacgatcatcgtcgtc
gccgagggtgcccttccccagccgggcacgatggagctgcccgagcccgagatggacaag
tacggccaccagatcctcggcgggatcgggtcgatcctcgcccgggagatccaggggcgg
accggcatcgagagccgcatgacggcgctcggccacatccagcgcggcggctcgccggtg
gccttcgaccgggtcctcgggacgcgattcggcgtcgccgcggtcgaggccgccctcgac
ggcgcgtgggggcagatggtggccctgcagcagggtcacatcgtccgggtgccgatctcc
gacgccgtcgggcagctgaagatggtcgacgcggacctgctccggctcaacacgatgttc
cagccacggatccccggcgacgagtaccccggcatacccgccgaccggcttgagcgcgtg
gaagactga

DBGET integrated database retrieval system