KEGG   Intrasporangium calvum: Intca_0250Help
Entry
Intca_0250        CDS       T01385                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ica  Intrasporangium calvum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ica01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ica00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ica00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ica00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
270237..271715
Genome map
AA seq 492 aa AA seqDB search
MAIRTFNLPDPGEGLVEAEIVEWKVAPGDTVKVNDMVLEIETAKSLVELPIPWSGTVREL
LVNVGDTVDVGTPIISIDDGQGGDAPAAPAGETAQAPKGEQQEANLVGYGAKAGATARRA
RKQGDGRMPLGSVPESAPARAAAPTETEQVAEAEPVAEQTAPAPRTESPAPAVEPVAREG
RPKAKPPVRKLAKDLGVDLWSVPGSGPDGIITRDDVESFARGVNLPERQGVSDQGEAAAS
VSAAPSPAAYPFGSGEREVRTPIKGVRKMTAQAMVGSAFTAPHVTEWVTVDVTRTMELVD
RLKRSREFKDVKVTPLLVLARAMILAIRRNPGVNATWDEAAQEIVQKNYVNLGIAAATPR
GLIVPNIKDAHGMSMLQLAQAIGELTATAREGRTQPAEMSGGTITITNVGVFGVDSGTPI
INPGESAIVAFGAIRKMPWVVEGPAGDEIVVRHVTQLAMSFDHRLVDGELGSRFLADLAA
IMADPGQALVWG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtggcaattcgcacgttcaacctgcccgaccccggtgagggtctcgtcgaggccgagatc
gtcgagtggaaggtcgctcccggcgacaccgtgaaggtcaacgacatggtcctcgagatc
gagacggccaagtcgctcgtcgagctgccgatcccgtggtccggcaccgtgagggagctc
ctcgtcaacgtcggcgacaccgtcgacgtcggcacgccgatcatcagcatcgacgacggt
cagggtggcgacgccccggccgcgccggcgggtgagacggcccaggcgccgaagggggag
cagcaggaggccaatctcgtcggctacggagccaaggccggagcgaccgctcgccgcgct
cgcaagcagggggatggccgtatgccgctgggctcggtccccgagtcggcgccggcacgc
gcggcggcacccaccgagacggagcaggttgccgaggccgagccggtcgccgagcagacc
gccccggctccgcgcaccgagtccccggcacccgccgtcgagccggtggcccgagaaggc
cgtcccaaggcgaagcccccggtccgcaagctcgccaaggacctgggtgtcgatctctgg
tcggtgccgggctccggccccgacggcatcatcacccgcgacgacgtcgagtccttcgcg
cgcggcgtcaacctccctgaacggcagggcgtttcggaccagggcgaggcggcggccagc
gtctccgcggcaccgagcccagcggcataccccttcggctcgggcgagcgggaggtgcgg
accccgatcaagggcgtgcgcaagatgaccgcgcaggcgatggtcgggtccgcgttcacc
gcgccgcacgtcaccgagtgggtcaccgtcgacgtgaccaggacgatggagctcgtcgac
cggctcaagcggtcgcgtgagttcaaggacgtcaaggtcacgccgctgctcgttctcgcc
agggcgatgatcctcgcgatcaggcgcaaccccggcgtcaacgcgacgtgggacgaggcg
gcgcaggagatcgtccagaagaactacgtcaacctcgggatcgccgcggccaccccgcga
gggctgatcgtcccgaacatcaaggacgcccacggcatgtcgatgctccagctcgcgcag
gccatcggcgaactgacggcgacggcgcgggaggggcggacgcagccggcggagatgtcg
ggcggcacgatcaccatcaccaacgtcggcgtcttcggcgtcgacagcggcaccccgatc
atcaacccgggcgagtcggcgatcgtcgcgttcggtgcgatccgcaagatgccgtgggtc
gtcgagggcccggccggcgacgagatcgtggtccggcacgtgacgcagctggcgatgagc
ttcgaccaccggctcgtcgacggcgagctggggtcgcgcttcctggctgacctcgcggcg
atcatggcggacccgggccaggccctggtctggggctga

DBGET integrated database retrieval system