KEGG   Intrasporangium calvum: Intca_0259Help
Entry
Intca_0259        CDS       T01385                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ica  Intrasporangium calvum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Intca_0259
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Intca_0259
   00650 Butanoate metabolism
    Intca_0259
  Lipid metabolism
   00071 Fatty acid degradation
    Intca_0259
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Intca_0259
   00310 Lysine degradation
    Intca_0259
   00360 Phenylalanine metabolism
    Intca_0259
   00380 Tryptophan metabolism
    Intca_0259
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Intca_0259
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Intca_0259
   00281 Geraniol degradation
    Intca_0259
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Intca_0259
   00627 Aminobenzoate degradation
    Intca_0259
   00930 Caprolactam degradation
    Intca_0259
Enzymes [BR:ica01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Intca_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281857..282633
Genome map
AA seq 258 aa AA seqDB search
MSEVTYTVADAVATITLSAPERRNALSVEMSRELIDAAQAAGQDHAVGAVVVTGGPHFCA
GAVRAVLADTGLDPVEDEAYRNLETVYRAFTTIGDLAVPTVAAVRGAAVGAGLNLALATD
LRIVSTSARLLPGFAQIGIHPGGGHFTLLGRVAGREAAAAMGLFGEEVDGARAVQLGLAW
AAHDDADVEAEAHALAARVAKDPELARRLVRSFRRETAPGGIPWDVAVELERSPQMWSLR
RKHGPRADRAERAEPDGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaagtgacctacaccgtggcggacgcagtcgcgacgatcaccctgtccgccccg
gagcggcgcaacgccctgtcggtcgagatgtcccgcgagctgatcgacgccgcgcaggcc
gcggggcaggaccacgccgtgggcgccgtcgtcgtcacgggcggcccgcacttctgcgcc
ggcgccgtccgcgccgtcctcgccgacaccggcctggaccccgtcgaggacgaggcctac
cgcaacctcgagacggtctaccgcgccttcacgaccatcggcgacctcgccgtgccgacc
gtcgcggccgtccgcggggccgccgtcggcgccggcctcaacctggcgctggccaccgac
ctgcgcatcgtctccacatccgcccggctgctgcccggcttcgcccagatcggcatccat
cccggcggcgggcacttcacgctcctgggccgggtggccgggcgggaggccgccgcggcg
atgggcctcttcggcgaggaggtcgacggtgcgcgggccgtccagctcggcctggcctgg
gccgcccacgacgacgccgacgtcgaggcggaggcgcacgccctggccgcccgcgtcgcc
aaggacccggagctcgcccgtcgcctcgtgcgcagcttccggcgggagaccgcccccggt
ggcatcccgtgggacgtcgccgtcgagctcgagcgctcgccgcagatgtggtcgctgcgg
cgcaagcacggtccgcgagccgatcgggccgaacgagctgaaccagacggtcgctga

DBGET integrated database retrieval system