KEGG   Intrasporangium calvum: Intca_0337Help
Entry
Intca_0337        CDS       T01385                                 

Definition
alcohol dehydrogenase GroES
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
ica  Intrasporangium calvum
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Intca_0337
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Intca_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363033..364058
Genome map
AA seq 341 aa AA seqDB search
MKAVRLVGYEQQPQLMDVPDPTPSSPLDVVIRIGGAGVCRTDLHIIEGQWEEKSGVALPY
TIGHENAGWVEAVGSAVTNVKPGDPVILHPLATCGLCRACRAGDDVHCVNSSFPGIDSDG
GYAEYLRTTARSVVRLDDSLEPADVAALADAGLTAYHAVAKAARVLRPGDTAVAIGAGGL
GHIGIQVFKALSPARLVVVDRSPEALELASELGADVTLRADGTQVEAIQELTQGNGAEAI
LDFVGEGGAVEDGVQMLRRAGNYYVIGYGGEIRVPTIDVISTEINFIGNLVGSYNDLVEL
MVLAAEDRVRLHTQRYALSDFQKALDDLDAGLVRGRAILVP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcagtcaggctcgtcgggtacgagcagcagccccagttgatggacgtcccggac
ccgaccccgagcagcccgctcgatgtcgtgatacgcatcggcggtgccggcgtgtgccgc
accgacctgcacatcatcgagggccagtgggaggagaagtcgggagtcgccctcccatac
acgatcggacacgagaacgccggctgggtcgaggccgtcgggtcggccgtcacgaacgtc
aagccgggggacccggtgatcctccacccactggccacctgcggcctctgccgcgcctgc
cgagccggggacgacgtgcattgcgtcaactcgtccttccccgggatcgacagcgacggt
gggtatgccgagtacctgcgcaccacagcccgctcggtcgtccggcttgacgactccctc
gagccggcggacgtcgcggcgctcgcggatgccggcctcacggcataccacgccgtggct
aaggccgcgcgcgtcctgcggcccggtgacacggccgttgccattggtgccggcgggctt
ggccacatcggcatccaggtcttcaaggccctctcgccggcacgactggtcgtcgtcgac
cggtcgccggaggcgctcgagctcgcgagcgagctcggtgccgacgtgaccctgcgcgcc
gacggcacccaggtcgaagccatccaggagctcacccaaggcaatggcgccgaggccatc
cttgacttcgtcggggaagggggcgctgttgaggacggggtccagatgctgcgccgcgcc
ggaaactactacgtcattggctacggcggcgagatccgcgttcccaccatcgacgtgatc
tccaccgagatcaacttcatcggcaatctcgtggggtcgtacaacgacctcgtcgagttg
atggtcctcgcagcggaggaccgggttcgcctgcacacccagcgctacgcgctgtccgac
ttccagaaggccttggacgacctcgacgcgggcctggtccgcggccgggcgattctcgtc
ccgtga

DBGET integrated database retrieval system