KEGG   Intrasporangium calvum: Intca_0337Help
Entry
Intca_0337        CDS       T01385                                 

Definition
alcohol dehydrogenase GroES
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ica  Intrasporangium calvum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ica01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ica00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ica00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ica00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ica00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:ica00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363033..364058
Genome map
AA seq 341 aa AA seqDB search
MKAVRLVGYEQQPQLMDVPDPTPSSPLDVVIRIGGAGVCRTDLHIIEGQWEEKSGVALPY
TIGHENAGWVEAVGSAVTNVKPGDPVILHPLATCGLCRACRAGDDVHCVNSSFPGIDSDG
GYAEYLRTTARSVVRLDDSLEPADVAALADAGLTAYHAVAKAARVLRPGDTAVAIGAGGL
GHIGIQVFKALSPARLVVVDRSPEALELASELGADVTLRADGTQVEAIQELTQGNGAEAI
LDFVGEGGAVEDGVQMLRRAGNYYVIGYGGEIRVPTIDVISTEINFIGNLVGSYNDLVEL
MVLAAEDRVRLHTQRYALSDFQKALDDLDAGLVRGRAILVP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcagtcaggctcgtcgggtacgagcagcagccccagttgatggacgtcccggac
ccgaccccgagcagcccgctcgatgtcgtgatacgcatcggcggtgccggcgtgtgccgc
accgacctgcacatcatcgagggccagtgggaggagaagtcgggagtcgccctcccatac
acgatcggacacgagaacgccggctgggtcgaggccgtcgggtcggccgtcacgaacgtc
aagccgggggacccggtgatcctccacccactggccacctgcggcctctgccgcgcctgc
cgagccggggacgacgtgcattgcgtcaactcgtccttccccgggatcgacagcgacggt
gggtatgccgagtacctgcgcaccacagcccgctcggtcgtccggcttgacgactccctc
gagccggcggacgtcgcggcgctcgcggatgccggcctcacggcataccacgccgtggct
aaggccgcgcgcgtcctgcggcccggtgacacggccgttgccattggtgccggcgggctt
ggccacatcggcatccaggtcttcaaggccctctcgccggcacgactggtcgtcgtcgac
cggtcgccggaggcgctcgagctcgcgagcgagctcggtgccgacgtgaccctgcgcgcc
gacggcacccaggtcgaagccatccaggagctcacccaaggcaatggcgccgaggccatc
cttgacttcgtcggggaagggggcgctgttgaggacggggtccagatgctgcgccgcgcc
ggaaactactacgtcattggctacggcggcgagatccgcgttcccaccatcgacgtgatc
tccaccgagatcaacttcatcggcaatctcgtggggtcgtacaacgacctcgtcgagttg
atggtcctcgcagcggaggaccgggttcgcctgcacacccagcgctacgcgctgtccgac
ttccagaaggccttggacgacctcgacgcgggcctggtccgcggccgggcgattctcgtc
ccgtga

DBGET integrated database retrieval system