KEGG   Intrasporangium calvum: Intca_0431Help
Entry
Intca_0431        CDS       T01385                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ica  Intrasporangium calvum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ica00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Intca_0431
DNA repair and recombination proteins [BR:ica03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Intca_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
470037..470636
Genome map
AA seq 199 aa AA seqDB search
MYEGAVQDLIDELGRLPGVGPKGAQRIAFHLLQADSDDVSRLVTALTEVKARVRFCEVCG
NVAEAERCRICADSRRDHTAICVVEEPKDIVAIERTREFRGTYHVLGGAISPIDGIGPDD
LRVRELMQRLASGEVQEVIIATDPNLEGEATATYLSRLLRDVGLTVTRLASGLPVGGDLE
YADEVTLGRAFEGRRRVDA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggcgcggtccaggacctgatcgatgagctcggccgactccccggcgtgggt
cccaagggcgcgcagcgcatcgccttccacctgcttcaggccgactccgatgacgtctcc
cgtctcgtcacggccctcaccgaggtcaaggcgagagtgcggttctgtgaggtctgcgga
aacgtggccgaggccgagcgctgccggatctgcgccgactcccgccgggaccacacggcg
atctgcgtcgtggaggagcccaaggacatcgtggcgatcgagcgcacgcgagagttccgc
ggcacctaccacgtcctgggcggcgcgatcagcccgatcgacggcatcggcccggacgac
ctgcgggtgcgtgagctcatgcagcgcctcgcctcgggggaggtgcaggaggtcatcatc
gccaccgatcccaacctcgagggtgaggcgaccgcgacctacctgtcacgcctgttgcgc
gacgtcggcctgaccgtcacccgcctcgcttccggcctgccagtgggcggcgacctcgag
tacgcggacgaggtcacgctcgggcgcgccttcgagggccgcaggcgggtcgacgcctga

DBGET integrated database retrieval system