KEGG   Intrasporangium calvum: Intca_0603Help
Entry
Intca_0603        CDS       T01385                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
ica  Intrasporangium calvum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Intca_0603
Enzymes [BR:ica01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Intca_0603
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     Intca_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
664384..665271
Genome map
AA seq 295 aa AA seqDB search
MTDEIVLRGVTARGHHGVLDAEKRDGQTFVVDVHLSLDLSRAGQTDDLSATVNYAEVASL
IVARITGPSFDLVERLAEVIADDVLDFGLVDSVEVVVHKPEAPVGHPFTDVEVRVRRSRG
PRAVIALGSNLGDRGRTLSLAVDALRSLPGFTVTSVSPIVESEPVGGPDQPPYLNAVVVG
RTTLVAADLLDALHRIEAAHGRTRDVRWDARTLDLDLIQVGTPGSAEEVVSDDETLTLPH
PRAGERAFVLVPWAAADPDARLRLGSADQEIRPVRQILGGLDQSGVRPGPEWGQS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacgagatcgtcctcaggggggtgaccgcccgcggccaccacggggtcctggac
gcggagaagcgggacggtcagaccttcgtcgtcgacgtccacctgtcgctcgacctgtcc
cgggccgggcagaccgacgacctgtccgccaccgtcaactatgccgaggtggcgtcgctc
atcgtggcccgcatcacggggccctcgttcgacctggtcgaacggttggccgaggtcatc
gccgacgacgtgctcgacttcgggctcgtcgactcggtcgaggtcgtggtccacaagccg
gaggcacccgtgggtcaccccttcacggacgtcgaggtgcgggttcgccgcagccgaggc
ccacgtgcggtcatcgcgctgggttcgaacctcggcgaccggggtcgcacgctgtcgctc
gcggtcgacgcactgcgttcgctgccgggtttcaccgtgacctccgtgtcgcccatcgtc
gagtccgagcccgtggggggaccggaccagccgccctacctgaacgccgtcgtcgtggga
cggacgaccctggtggccgccgacctgctcgacgcgctccaccgcatcgaggccgcccac
ggccggacgcgcgacgtgagatgggacgcccgcaccctggacctcgacctcatccaggtc
ggcactccgggatcggcggaggaggtggtgagcgacgacgaaaccctcaccctcccgcac
cctcgcgccggagagcgtgccttcgtgctcgtgccctgggctgctgcggaccctgatgcg
cgtctccggctcggctccgcggaccaggagatccgtcccgtccggcagatcctcggcggt
ctggaccagtcgggcgtccgcccgggccccgagtggggccagtcgtga

DBGET integrated database retrieval system