KEGG   Intrasporangium calvum: Intca_0660Help
Entry
Intca_0660        CDS       T01385                                 

Definition
uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ica  Intrasporangium calvum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Intca_0660
Enzymes [BR:ica01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Intca_0660
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Intca_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
718556..720202
Genome map
AA seq 548 aa AA seqDB search
MTRTRQPSEQTATIPTVPTMPARVAFVGSGPGDPGLLTVRARDLLAAADVVVLDGLMREE
AVLGHAREDVQIIDAAHGENGQELTHAVRAKLVVKAAKSVSNGGLVVRLMDGDPATFNGL
VEEARACRKAGITFDVVPGVSAATAVATYAGVPLTSKGTSSVHVLNADQSGHDLTRYCTD
DDTLVILGSPRSIGLALTGLLECGRPAEAQVALVEQGTTVRQTSFTTTLGAAEAALDRLT
GQISAAVVSPNVAMRDEFSWFETKPLFGWKVLVPRTQAQAGSMIDRLAAYGAVADVVPTI
SVEPPRTPQQMEKAVRGLVTGRYEWIGFTSTNAVRAVRERFEELGLDARAFAGLKVAAVG
GVTADALREWGINPDLVPSGEQSAAGLLEVWPEFDEVLDPINRVLLPRADIATETLVAGL
RDIGWEVDDVTAYRTVRAAPPAQHVRDAIKGGDYDAVLFTSSSTVRNLVGIAGKPHPATV
VACIGPATAKTAEEHGLRVDVLAPEASALSLVDALAGHGVGLAVAAAETGQALQRPSDKR
PASRRRAR
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgcacacgccagccgtcagagcagacggcgacgatccccacggtcccgaccatg
ccggcgcgcgtcgccttcgtcgggtccgggccaggcgacccagggctgctgacggtccgc
gcccgcgacctcctcgccgcggccgacgtcgtcgtgctcgacggcctgatgcgcgaggag
gcggtcctcgggcacgcccgcgaggacgtgcagatcatcgacgccgcacacggcgagaac
ggtcaggagctgacgcacgcggtccgggccaagctcgtcgtcaaggccgccaagtcggtc
tccaacggcggcctcgtggtgcgcctcatggacggtgacccggcgacgttcaacggcctc
gtcgaggaggcgcgcgcctgtcgcaaggccggcatcacgttcgacgtcgtccccggtgtc
tcggccgcgaccgccgtggcgacctacgccggggtgccgctcacctccaagggcacctcg
tcggtccacgtcctcaacgcggaccagtccgggcacgacctgacccgctactgcaccgac
gacgacaccctcgtcatcctcggctcgccgcggtcgatcggcctggccctgaccggcctg
ctcgagtgtggtcgccccgcagaggcgcaggtggcgctcgtcgagcagggcaccaccgtt
cgccagacctccttcaccaccacgctcggcgccgccgaggcggcgctcgaccgcttgacc
ggtcagatctcggccgccgtcgtgtccccgaacgtcgcgatgcgtgacgagttctcctgg
ttcgagacgaagccgctcttcgggtggaaggtcctggttccccgcacccaggcccaggcc
gggtcgatgatcgaccggctcgccgcctacggcgcggtcgcggacgtcgtgccgacgatc
tcggtcgagccgccccggacgcctcagcagatggagaaggccgtccgcggcctcgtcacc
ggacgttacgagtggatcggcttcacctcgacgaacgccgttcgtgccgtgcgtgagcgg
ttcgaggagctcgggctcgacgcccgtgccttcgccgggctcaaggtcgccgccgtcggt
ggcgtcaccgccgacgccctgcgcgagtggggcatcaaccccgacctcgtgccgagcggc
gagcagtcggctgccggcctcctcgaggtgtggccggagttcgacgaggtgctcgacccg
atcaaccgggtgctcctgccgcgggccgacatcgccaccgagacgctcgtcgccggcctg
cgggacatcggctgggaggtcgacgacgtcaccgcctaccggaccgtccgtgcggcgccg
cccgcccagcacgtgcgcgacgcgatcaagggcggcgactacgacgcggtgctcttcacc
tcgagctccacggtccgcaacctcgtcggcatcgccggcaagccgcaccccgccaccgtc
gtcgcgtgcatcggcccggccacggccaagaccgcggaggagcacggcctgcgggtcgac
gtcctcgcccccgaggcatcggccctcagcctcgtcgacgccctcgccgggcacggggtg
ggtctggcggtggccgctgcggagaccggccaggcgctgcagcgccccagtgacaagcgg
cccgcgtcccgacgccgggcccgctga

DBGET integrated database retrieval system