KEGG   Intrasporangium calvum: Intca_0661Help
Entry
Intca_0661        CDS       T01385                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ica  Intrasporangium calvum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Intca_0661
Enzymes [BR:ica01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Intca_0661
Exosome [BR:ica04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Intca_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
720218..721183
Genome map
AA seq 321 aa AA seqDB search
MIERPRRLRQNPALRALVAETRLHPKDLVLPAFVAEGADSVRPIPSMPGVVQHTLDTLVA
EARRAVDLGIGGIMLFGVPTTKDARGSGGTEPSGILNVALERVRAEVGDELVVMADTCLD
EFTDHGHCGVLDDRGRVDNDATLEIYGEMAVAQARAGAHVVGPSGMMDGQVAAIREALDA
AGFTDTVVLAYAAKYASAFYGPFRDAVQSSLEGDRRTYQQDPANVVESLREIDLDLAEGA
DLVMVKPAMSYLDVVSAAAERSSVPVAAYQVSGEYSMVCAAAANGWIDRRAAALESLLSI
RRAGAQVVLTYFALEAADWLG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagcgaccgcgccgcctccggcagaaccccgcactccgggccctcgtcgccgag
acccgcctgcaccccaaggacctcgtgctgccggccttcgtggccgagggcgccgactcg
gtccggcccatcccgagcatgcccggcgtcgtccagcacacgctcgacacgctggtggcg
gaggcgcgccgggcggtcgacctcggcatcggcggcatcatgctcttcggcgtcccgacc
acgaaggatgcccgcggctcgggcgggaccgagcccagcggcatcctcaatgtcgccctg
gagcgggtccgcgcggaggtcggcgacgagctcgtcgtcatggccgacacgtgcctcgac
gagttcaccgaccacgggcactgcggcgtgctcgacgaccggggccgggtcgacaacgac
gcgacgctcgagatctacggcgagatggcggtggcccaggcccgcgccggtgcccacgtc
gtcggtccctcagggatgatggacggccaggtcgccgccatccgcgaggcgctcgacgcg
gcggggttcacggacacggtcgtcctcgcctacgcggccaagtatgcatccgccttctac
ggcccgttccgcgacgcggtgcagtcgagcctggagggagaccggcgcacctaccagcag
gaccccgccaacgtcgtcgagtcgctccgcgagatcgacctcgacctcgcggagggggcc
gacctcgtcatggtcaagccggcgatgtcctacctcgacgtcgtctccgcggccgccgag
cggtcctccgtgccggtcgccgcctaccaggtgtcgggggagtactccatggtctgtgcc
gccgccgccaacggctggatcgaccggcgagcggcggcgctcgagtcgctgctgtccatc
cggcgggccggtgcccaggtcgtcctcacctacttcgcgctggaagcggcggactggctc
ggctga

DBGET integrated database retrieval system