KEGG   Intrasporangium calvum: Intca_0825Help
Entry
Intca_0825        CDS       T01385                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ica  Intrasporangium calvum
Pathway
ica00620  Pyruvate metabolism
ica00630  Glyoxylate and dicarboxylate metabolism
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01120  Microbial metabolism in diverse environments
ica01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Intca_0825
   00630 Glyoxylate and dicarboxylate metabolism
    Intca_0825
Enzymes [BR:ica01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Intca_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADU47357
UniProt: E6SBM6
Position
901289..902869
Genome map
AA seq 526 aa AA seqDB search
MRVTEGVQITAESGGRFAEILTEPAIEFLGSLHRAFDARRLELLRAREVRYEQLVAGHQL
EFLPDTKEVREGDWQVAPPAPGLVDRRVEITGPTDRKMTINALNSGAKVWLADFEDASTP
TWDNVVQGQLNLIDALDRKIDYTSDEGKSYALRPAEELATIVVRPRGWHLSEKHVLVDGE
PMSGSLVDFGLYFFHCAQRQIDAGKGPYFYLPKMESHLEARLWNDVFVHAQDHVGIPQGT
IRATCLIETYPAAFEMEEILYELRDHSSGLNAGRWDYIFSVIKKFRTRGRDFLLPDRNQV
TMTVPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRDPEVNEAAFQKVTDDKTREANDGF
DGSWVAHPGMVELCKEAFTKVLGDRPNQIDKKREDVEVTAEQLLDVKATPGTVTEAGLRN
NISVGVQYLHTWLKGSGAVGIFNLMEDAATAEISRSQVWQWLHNDVELDTGTKVTRELID
RLVEEEVAKLPGDPADYDEARSTFLEVAVADDFAEFLTLPAYERMP
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagagtgaccgaaggcgtgcagatcacggccgagagcggcggacggttcgcggagatc
ctcacggagccggcgatcgagttcctcggttcgctgcaccgggcgttcgacgcgcgacgt
ctggagctcctccgggcgcgggaggtgcgctacgagcagctcgtcgcgggtcaccagctc
gagttcctccccgacaccaaggaggtccgcgagggggactggcaggtcgccccgccggcg
cccggactcgtcgaccgccgcgtcgagatcaccggcccgaccgaccgcaagatgacgatc
aacgccctcaactcgggggccaaggtgtggctcgccgatttcgaggacgcctcgacgccc
acgtgggacaacgtcgtccagggccagctcaacctcatcgacgcccttgaccgcaagatc
gactacacgagcgacgagggcaagtcctacgccctgcgccccgccgaggagctggcgacc
atcgtcgtccgcccccgcggctggcacctgtccgagaagcacgtcctcgtcgacggtgag
ccgatgtccggctcgctcgtcgacttcggtctctacttcttccactgcgcccagcgccag
atcgacgccgggaagggtccctacttctacctgccgaagatggagagccacctggaggcc
cggctctggaacgacgtgttcgtccacgcgcaggaccacgtgggcatcccgcagggcacg
atccgcgccacctgcctcatcgagacctacccggccgccttcgagatggaggagatcctc
tacgagctccgggaccactcctcgggcctcaacgccgggcggtgggactacatcttcagc
gtcatcaagaagttccgcacgcgagggcgcgacttcctcctgccggaccgcaaccaggtg
accatgaccgtgccgttcatgagggcctacacggagctgctcgtgcggacctgccacaag
cgcggtgcccacgccatcggcgggatggcggcgttcatcccgagccgcgacccggaggtc
aacgaggccgcgttccagaaggtgaccgacgacaagacccgcgaggcgaacgacggcttc
gacgggtcgtgggtggctcaccccggcatggtggagctctgcaaggaggcgttcaccaag
gtcctgggtgaccggcccaaccagatcgacaagaagcgggaggacgtcgaggtcaccgct
gagcagctgctcgacgtgaaggcgacccccgggacggtgaccgaggccggcctgcggaac
aacatcagcgtcggggtccagtacctccacacgtggctcaagggctccggtgcggtcggc
atcttcaacctcatggaggacgcggcgacggccgagatctcccgctcgcaggtgtggcag
tggctgcacaacgacgtcgagctcgacacgggcacgaaggtcacccgcgagctcatcgac
cggttggtcgaggaggaggtcgccaagctgccgggagaccctgccgactacgacgaggcg
cgctccaccttcctcgaggtcgccgtcgccgacgacttcgccgagttcctcacgctgccg
gcctacgagcggatgccctga

DBGET integrated database retrieval system