KEGG   Intrasporangium calvum: Intca_0858Help
Entry
Intca_0858        CDS       T01385                                 

Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ica  Intrasporangium calvum
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ica01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:ica00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ica00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
935985..937199
Genome map
AA seq 404 aa AA seqDB search
MAGNRVVVYKGPGEVSIESVDYPKLELPEDVVNGLGIKKKAPHAAILKLVTTNICGSDQH
MVRGRTTAPVGQTLGHEITGEVVEVGEDVLFVKEGDICSVPFNIACGRCRMCNEGKTGIC
LNVNPARAGAAYGYVDMGGWLGGQAEYVMVPFADFNLLKFPDRDQALAKILDLTMLSDIF
PTGYHGAYTAGVTTGSTVYVAGAGPVGLAAAYSAQLLGAATVIVGDMNAERLRQAESFGC
ATVDLSTGNELPDMIEQILGEPEVDAAVDAVGFEARGHGAGAGEAPATVLNDMMTVARAG
ASLGVPGLYVTGDPGGVDESAKIGQIGVRLGLGWAKSHSFTTGQCPVKRYNRQLMNMILA
DKAHIAKAVNATRISLDEAPQGYQEFDKGAAKKYVIDPHGMVSA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtaaccgtgtcgtcgtctacaagggtccgggcgaggtgagcatcgagtcggtc
gactacccgaagctcgagcttcccgaggatgtggtcaatggcctcggaatcaagaagaag
gctccgcacgccgcgatcctcaagctggtcaccaccaacatctgcggcagcgaccagcac
atggtgcgtggacgcaccacggcgcccgtcggccagaccctgggccacgagatcaccggt
gaggtcgtcgaggtcggcgaggacgtcctgttcgtgaaggagggggacatctgctcggtg
ccgttcaacatcgcgtgcgggcggtgccggatgtgcaacgagggcaagacgggcatctgc
ctcaacgtgaaccctgcgcgagccggggcggcttacgggtacgtcgacatgggtggctgg
ctgggcggccaggcggagtacgtcatggtgccattcgccgacttcaacctgttgaagttc
cccgaccgggaccaggcgctggcgaagatcctcgacctgacgatgctctccgacatcttc
ccgacgggctaccacggcgcgtacacagccggggtcaccacgggatcgaccgtctacgtc
gcgggcgccggcccggtcggactggccgccgcctactcagcacagctcctcggggccgcc
accgtcatcgttggcgacatgaacgccgagcggctgcgccaggctgagtccttcgggtgc
gcgacggtggacctcagcacgggcaacgagctgcccgacatgatcgagcagatcctcggc
gagccagaggtcgacgcggcggtcgacgcagtcggcttcgaggcccgcggccacggtgcc
ggagcaggcgaggcgccggcgaccgttctcaacgacatgatgaccgtcgcgcgagcgggt
gcgtcgctgggcgtcccggggctgtacgtgaccggtgacccgggcggcgtcgacgagagc
gccaagatcggccagatcggtgtccggctcggactcggctgggctaagtcgcactccttc
accacggggcagtgcccggtgaagcgctacaaccggcagctgatgaacatgatcctggcc
gacaaggcccacatcgcgaaggcggtcaacgcgaccaggatcagcctcgacgaggccccg
cagggctaccaggagttcgacaagggtgcggcgaagaagtacgtgatcgacccccacggg
atggtcagcgcctga

DBGET integrated database retrieval system