KEGG   Intrasporangium calvum: Intca_0858Help
Entry
Intca_0858        CDS       T01385                                 

Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ica  Intrasporangium calvum
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Intca_0858
  Energy metabolism
   00680 Methane metabolism
    Intca_0858
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Intca_0858
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Intca_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
935985..937199
Genome map
AA seq 404 aa AA seqDB search
MAGNRVVVYKGPGEVSIESVDYPKLELPEDVVNGLGIKKKAPHAAILKLVTTNICGSDQH
MVRGRTTAPVGQTLGHEITGEVVEVGEDVLFVKEGDICSVPFNIACGRCRMCNEGKTGIC
LNVNPARAGAAYGYVDMGGWLGGQAEYVMVPFADFNLLKFPDRDQALAKILDLTMLSDIF
PTGYHGAYTAGVTTGSTVYVAGAGPVGLAAAYSAQLLGAATVIVGDMNAERLRQAESFGC
ATVDLSTGNELPDMIEQILGEPEVDAAVDAVGFEARGHGAGAGEAPATVLNDMMTVARAG
ASLGVPGLYVTGDPGGVDESAKIGQIGVRLGLGWAKSHSFTTGQCPVKRYNRQLMNMILA
DKAHIAKAVNATRISLDEAPQGYQEFDKGAAKKYVIDPHGMVSA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtaaccgtgtcgtcgtctacaagggtccgggcgaggtgagcatcgagtcggtc
gactacccgaagctcgagcttcccgaggatgtggtcaatggcctcggaatcaagaagaag
gctccgcacgccgcgatcctcaagctggtcaccaccaacatctgcggcagcgaccagcac
atggtgcgtggacgcaccacggcgcccgtcggccagaccctgggccacgagatcaccggt
gaggtcgtcgaggtcggcgaggacgtcctgttcgtgaaggagggggacatctgctcggtg
ccgttcaacatcgcgtgcgggcggtgccggatgtgcaacgagggcaagacgggcatctgc
ctcaacgtgaaccctgcgcgagccggggcggcttacgggtacgtcgacatgggtggctgg
ctgggcggccaggcggagtacgtcatggtgccattcgccgacttcaacctgttgaagttc
cccgaccgggaccaggcgctggcgaagatcctcgacctgacgatgctctccgacatcttc
ccgacgggctaccacggcgcgtacacagccggggtcaccacgggatcgaccgtctacgtc
gcgggcgccggcccggtcggactggccgccgcctactcagcacagctcctcggggccgcc
accgtcatcgttggcgacatgaacgccgagcggctgcgccaggctgagtccttcgggtgc
gcgacggtggacctcagcacgggcaacgagctgcccgacatgatcgagcagatcctcggc
gagccagaggtcgacgcggcggtcgacgcagtcggcttcgaggcccgcggccacggtgcc
ggagcaggcgaggcgccggcgaccgttctcaacgacatgatgaccgtcgcgcgagcgggt
gcgtcgctgggcgtcccggggctgtacgtgaccggtgacccgggcggcgtcgacgagagc
gccaagatcggccagatcggtgtccggctcggactcggctgggctaagtcgcactccttc
accacggggcagtgcccggtgaagcgctacaaccggcagctgatgaacatgatcctggcc
gacaaggcccacatcgcgaaggcggtcaacgcgaccaggatcagcctcgacgaggccccg
cagggctaccaggagttcgacaagggtgcggcgaagaagtacgtgatcgacccccacggg
atggtcagcgcctga

DBGET integrated database retrieval system