KEGG   Intrasporangium calvum: Intca_0891Help
Entry
Intca_0891        CDS       T01385                                 

Definition
molybdenum cofactor synthesis protein (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ica  Intrasporangium calvum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Intca_0891
   00052 Galactose metabolism
    Intca_0891
   00500 Starch and sucrose metabolism
    Intca_0891
   00520 Amino sugar and nucleotide sugar metabolism
    Intca_0891
Enzymes [BR:ica01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Intca_0891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
975707..978364
Genome map
AA seq 885 aa AA seqDB search
MSDQGLARAVERMRGRGMGPEAITVFEHYYRQLEEGAQGTIPEDTIEPLRDIQALGEVEV
SDEDARRALSQTAVIKLNGGLGTSMGMSGAKSALEVKDGLTFLDIIAQQVLSLREQWGVE
LPLILMNSFRTSEQSLDILATYPDLPVDGLPLDFIQSAEPKLLADSLDPVDWPPDRELEW
CPPGHGDIYVSLVTSGVLDSLLAKGIRYAFISNSDNLGATCDPDVAAWMVEHGLPFVAEV
CTRTKSDRKGGHLATRRSDGRLILRDTAMVAEGEERFFADTKRHDTFNANNIWVDLSVLR
DRMAERAGFLGLPIIINRKTVDPADPTSPEVVQLESAMGAAIEVFEGSEALLVPRTRFRP
VKTTNDLLVVRSDYFVLDESYHLLAVGEGPEPFVDLDSAYRLVDGFEKRFPFGVPSMVEC
TSLRVIGDPVFGRDVRCVGDVLVDGLRRVRDHAVLEGPVAGETAAEGRPAARAQGVADLR
TVDQHLRAILSTLEPAATASVPLTEALGLVVARDVRSRVSLPPFDNSSMDGYAVRARSLD
GADATPVSLRIVGEVAAGANPTFSVGPGEAARIMTGAPIPTGADAVIAVEDTDGAAEGPV
LCRAVVAPGRYIRPRGEDVSEGAVVVSAGDVVGPRTIALLAACGHATVEVHRRPHVVILS
TGAELVPPGEPLQPGQIHDSNSTMLWAAAISAGASAEIRGTVGDTDAELLVALDEVVAGA
DVVVTSGGVSMGAYDVVKSALADRGVDFVRVAMQPGKPQGFGYLTGPVGRRVPLFALPGN
PVSSFVSFEVFVRPALRRLMRLTPEKRRVRSATLTSGLRSPEGRRQFGRAVVSRNSEGAL
MCTPVAGQGSHFVADLSRANALFIVPEETADLVAGERVDVIILDD
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccaggggttggcccgcgccgtcgaacggatgcgcgggcgagggatgggaccc
gaggccatcacggtcttcgagcactactaccgtcagctcgaggagggggcgcagggcacg
atccccgaggacaccatcgagccgctccgggacatccaggccctcggcgaggtggaggtc
tcggacgaggacgcccgccgggcgctgagccagaccgcggtgatcaagctcaacggtggg
ctcggcacgagcatggggatgagcggcgccaagtcggcgctcgaggtcaaggacggactg
accttcctcgacatcatcgcccagcaggtgctctcgctccgcgagcagtggggggtcgag
ctgcccctcatcctgatgaactcgttccggacctcggagcagtcgctcgacatcctcgcc
acctacccggacctccccgtcgacgggctcccgctcgacttcatccagagcgccgagccg
aagctcctcgccgactccctcgacccggtcgactggcctccggaccgcgagctcgagtgg
tgcccgcccggccacggcgacatctacgtctccctcgtcacgtccggcgtgctcgacagc
ctgctggccaaggggatccgctacgcgttcatctccaactcggacaacctcggcgccacc
tgcgaccccgacgtggcggcgtggatggtcgagcacgggctgcccttcgtcgccgaggtg
tgcacccgcacgaagagcgaccgcaagggcgggcacctcgcgactcgcaggtccgacggc
cgcctcatcctccgtgacacggcgatggtggccgagggcgaggagcggttcttcgccgac
accaagcgccacgacacgttcaacgccaacaacatctgggtcgacctgtccgtcctgcgc
gaccggatggccgagcgggccggtttcctcggcctgcccatcatcatcaaccgcaagacg
gtcgacccggccgaccccacgtcgcccgaggtcgtccagctcgagtccgcgatgggtgcc
gcgatcgaggtgttcgaggggtccgaggcgctgctcgtgccgcgcacgcggttccggccg
gtcaagacgaccaacgacctgctcgtcgtccgctcggactacttcgtgctcgacgagagc
taccacctcctcgcggtgggggagggccccgagccgttcgtcgacctcgactcggcctac
cggctcgtggacggcttcgagaagcgcttccccttcggggtcccgtcgatggtcgagtgc
accagcctgcgcgtcatcggcgacccggtcttcgggcgcgatgtccgctgcgtcggcgac
gtcctcgtcgacgggctgaggagggtgcgcgaccacgcggtcctcgagggcccggtcgcg
ggcgagaccgcggcggaggggcgccctgcggcgcgggctcagggtgtcgccgacctgcgg
accgtcgaccagcacctccgcgcgatcctgtcgaccctggagccggccgcgacggcgagc
gtgccgctcaccgaggcgctcgggctcgtcgtcgcgagggacgtccggtcccgggtcagc
ctgccgcccttcgacaactcgtcgatggacggctatgcggtccgggcccggtccctcgac
ggggccgacgcgacgccggtgtcgttgcggatcgtcggtgaggtggccgctggggccaac
ccgaccttctcggtgggccccggcgaggccgcccgcatcatgacgggcgcgccgatcccg
accggcgccgacgcggtcatcgccgtggaggacaccgacggcgcggccgagggcccggtc
ctctgtcgggcggtcgtcgccccgggccggtacatccgaccgcgtggcgaggacgtctcc
gaaggtgccgtcgtcgtgtcggccggcgacgtcgtcgggccgcggacgatcgccctgctc
gccgcctgcggccacgcgacggtcgaggtgcaccggcggccgcacgtcgtcatcctgtcg
accggcgcggagctcgtcccgccgggcgagcccctccagccgggccagatccacgactcc
aactcgacgatgctctgggcggccgcgatctccgcgggtgcctcggccgagatccgcgga
accgtcggcgacactgacgccgagctgctcgtcgccctcgacgaggtcgtggccggcgcg
gacgtcgtggtcacgagcggtggggtctcgatgggcgcctacgacgtggtcaagagcgcg
ctcgccgaccgcggcgtggacttcgtcagggtggcgatgcagccgggcaagccacagggc
ttcggctacctcacgggcccggttggtcgtcgcgtgccgctgttcgcgctgccgggcaac
ccggtctcctcgttcgtctcgttcgaggtcttcgtccggccggcgctgcgccgtctgatg
cgcctcacgccggagaagcgccgggtccgcagcgccacgctcacctcaggactgcgctcg
cccgaggggcggcggcagttcggccgcgccgtcgtgtcgcgcaactccgagggtgcgctg
atgtgcacgccggtcgcggggcagggctcgcacttcgtcgccgacctgtcccgggccaac
gcgctgttcatcgtcccggaggagaccgcggacctcgtcgccggtgagcgcgtcgacgtc
atcatcctcgacgactga

DBGET integrated database retrieval system