KEGG   Intrasporangium calvum: Intca_0899Help
Entry
Intca_0899        CDS       T01385                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
ica  Intrasporangium calvum
Pathway
ica00010  Glycolysis / Gluconeogenesis
ica00071  Fatty acid degradation
ica00350  Tyrosine metabolism
ica00625  Chloroalkane and chloroalkene degradation
ica00626  Naphthalene degradation
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01120  Microbial metabolism in diverse environments
ica01130  Biosynthesis of antibiotics
ica01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Intca_0899
  Lipid metabolism
   00071 Fatty acid degradation
    Intca_0899
  Amino acid metabolism
   00350 Tyrosine metabolism
    Intca_0899
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Intca_0899
   00626 Naphthalene degradation
    Intca_0899
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Intca_0899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C UDPG_MGDP_dh_N ELFV_dehydrog Pyr_redox_2 XdhC_C TrkA_N 3HCDH_N adh_short FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADU47426
UniProt: E6SC82
Position
985074..986120
Genome map
AA seq 348 aa AA seqDB search
MRAVVYDEIGASPEVRDVPSPEAPAGGVVVEVHATGLCRSDWHAWAGHDDIALPHVPGHE
LAGIVASVGVGVRDWSVGDRVTVPFVEGCGRCEWCLGGDAQVCPAQEQPGFTHWGSFAEY
VALHAADTNLVAVPDDVSFEAAAALGCRFATAWRALTGRAAVRPGEWVTVVGAGGVGLST
VMIAKSLGAKVIAVDRNRGALAAAEALGADAVLEADGSDVPAAVHELTSGGSHVAVDAVG
SEATCADAILSLRRRGRHVQVGLLPPVDGHPRVPMARVIGWELDVLGSHGMAAVDYPGMM
ALIASGQLRPQTLVERVVGLEEAAVLLPLLEQAAPAGMTMIDPRPAAG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagccgtggtctacgacgagatcggcgcgagccccgaggtgcgcgatgtgccctcg
ccggaggcgcctgcgggcggggtcgtcgtcgaggtccacgccaccggcctctgccgcagc
gactggcacgcctgggccggtcacgacgacatcgcgctcccgcacgtcccggggcacgag
ctggccgggatcgtcgcgtccgtcggtgtcggggtgcgcgactggtcggtgggggaccgg
gtgaccgtcccgttcgtcgagggctgtgggcggtgcgagtggtgcctcggcggggacgcg
caggtgtgtcccgcccaggagcagcccggcttcacgcactggggctcgttcgccgagtac
gtcgccctgcacgcggccgacaccaacctcgtggccgtgcccgacgacgtgtccttcgag
gccgcggcagccctcgggtgccggttcgcgacggcctggcgcgcgctgaccgggcgggcc
gcggtgcgaccgggcgagtgggtgaccgtcgtgggtgccgggggcgtcggactgtccacg
gtgatgatcgcgaagtccttgggcgccaaggtcattgccgtcgaccgcaaccgtggcgcg
ctggctgcggccgaggcgttgggggcggacgcggtgctcgaggcggacggctcggacgtc
ccggcagcggtccacgagctcacctccggaggcagtcacgtcgccgtggacgccgtgggc
agcgaggcgacctgcgccgacgcgatcctctcgttgcggaggcgcggccggcacgtccag
gtcgggctgctgccgccggtggacggtcacccccgcgtgccgatggcgcgcgtcatcggc
tgggagctggacgtgctcggctcacacggaatggcggccgtcgactacccggggatgatg
gcgctcatcgcgtccgggcagctgcggccccagacgctcgtggagcgggtcgtcggcctc
gaggaggcggctgtgctcctgcccctcctagagcaggctgccccggcgggaatgacgatg
atcgatccgaggcccgcggctgggtga

DBGET integrated database retrieval system