KEGG   Intrasporangium calvum: Intca_0899Help
Entry
Intca_0899        CDS       T01385                                 

Definition
alcohol dehydrogenase zinc-binding domain protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ica  Intrasporangium calvum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Intca_0899
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Intca_0899
  Lipid metabolism
   00071 Fatty acid degradation
    Intca_0899
  Amino acid metabolism
   00350 Tyrosine metabolism
    Intca_0899
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Intca_0899
   00626 Naphthalene degradation
    Intca_0899
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Intca_0899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985074..986120
Genome map
AA seq 348 aa AA seqDB search
MRAVVYDEIGASPEVRDVPSPEAPAGGVVVEVHATGLCRSDWHAWAGHDDIALPHVPGHE
LAGIVASVGVGVRDWSVGDRVTVPFVEGCGRCEWCLGGDAQVCPAQEQPGFTHWGSFAEY
VALHAADTNLVAVPDDVSFEAAAALGCRFATAWRALTGRAAVRPGEWVTVVGAGGVGLST
VMIAKSLGAKVIAVDRNRGALAAAEALGADAVLEADGSDVPAAVHELTSGGSHVAVDAVG
SEATCADAILSLRRRGRHVQVGLLPPVDGHPRVPMARVIGWELDVLGSHGMAAVDYPGMM
ALIASGQLRPQTLVERVVGLEEAAVLLPLLEQAAPAGMTMIDPRPAAG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagccgtggtctacgacgagatcggcgcgagccccgaggtgcgcgatgtgccctcg
ccggaggcgcctgcgggcggggtcgtcgtcgaggtccacgccaccggcctctgccgcagc
gactggcacgcctgggccggtcacgacgacatcgcgctcccgcacgtcccggggcacgag
ctggccgggatcgtcgcgtccgtcggtgtcggggtgcgcgactggtcggtgggggaccgg
gtgaccgtcccgttcgtcgagggctgtgggcggtgcgagtggtgcctcggcggggacgcg
caggtgtgtcccgcccaggagcagcccggcttcacgcactggggctcgttcgccgagtac
gtcgccctgcacgcggccgacaccaacctcgtggccgtgcccgacgacgtgtccttcgag
gccgcggcagccctcgggtgccggttcgcgacggcctggcgcgcgctgaccgggcgggcc
gcggtgcgaccgggcgagtgggtgaccgtcgtgggtgccgggggcgtcggactgtccacg
gtgatgatcgcgaagtccttgggcgccaaggtcattgccgtcgaccgcaaccgtggcgcg
ctggctgcggccgaggcgttgggggcggacgcggtgctcgaggcggacggctcggacgtc
ccggcagcggtccacgagctcacctccggaggcagtcacgtcgccgtggacgccgtgggc
agcgaggcgacctgcgccgacgcgatcctctcgttgcggaggcgcggccggcacgtccag
gtcgggctgctgccgccggtggacggtcacccccgcgtgccgatggcgcgcgtcatcggc
tgggagctggacgtgctcggctcacacggaatggcggccgtcgactacccggggatgatg
gcgctcatcgcgtccgggcagctgcggccccagacgctcgtggagcgggtcgtcggcctc
gaggaggcggctgtgctcctgcccctcctagagcaggctgccccggcgggaatgacgatg
atcgatccgaggcccgcggctgggtga

DBGET integrated database retrieval system