KEGG   Intrasporangium calvum: Intca_0950Help
Entry
Intca_0950        CDS       T01385                                 

Definition
dihydrodipicolinate synthetase
Orthology
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
ica  Intrasporangium calvum
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Intca_0950
  Amino acid metabolism
   00300 Lysine biosynthesis
    Intca_0950
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Intca_0950
Enzymes [BR:ica01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     Intca_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049557..1050489
Genome map
AA seq 310 aa AA seqDB search
MTTATPFHGLVPPVVTPLGEDLTVDVASLERLVARMIDAGVDGLFALGSSGETVLLDDAQ
RDLALEVIVKTADGRVPVIAGAIEPGTARSVQRARAAERLGAQAVVATAPFYVIVGPHEI
ERHFRSVAAAVDVPLFAYDIPVCVHSKLSNDLVLRLAHDGVIAGVKDSSGDDVGFRQLLV
QVAAEGLSDFATLTGHEVMVDSMLLAGASGSVPGLANVDPAGYARLHAAVAAGDVAAARA
EQERLIQLFRIVDAADPATSAGMTRGAGSFKTALHVLGVIDSNAISLPLRALDDAESGRV
REVLESVGLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcaacacccttccatggcctcgtgccgccggtcgtcaccccgctgggcgag
gacctgaccgtcgacgtcgcctcgctcgagcgcctcgtggcccggatgatcgacgcgggc
gtcgacgggctcttcgccctcggcagcagcggcgagaccgtcctcctcgacgacgcgcag
cgcgacctcgccctcgaggtcatcgtcaagaccgcagacggacgggtgccggtcatcgcc
ggcgccatcgagccgggcacggcccggtcggtccagcgcgcccgcgccgccgagcggctc
ggcgcccaggcggtggtggccacggcgcccttctacgtcatcgtcggcccgcacgagatc
gagcggcacttccgctccgtcgcggccgccgtcgacgtgccgttgttcgcctacgacatc
ccggtctgcgtccactccaagctctcgaacgacctcgtcctgcgcctcgcgcacgacggt
gtcatcgcgggtgtcaaggactcgagcggcgacgacgtcggcttccggcagctcctcgtc
caggtggccgcggaagggctgtccgacttcgccaccctgaccggccacgaggtgatggtc
gactcgatgctcctcgcgggcgcgagcggctccgtgcccgggctggccaacgtcgacccc
gccggctacgcccgcctgcacgcggcggtcgcggccggcgacgtcgcggcggcccgtgcc
gagcaggagcgcctcatccagctgttccggatcgtcgacgcagccgacccggccacctct
gccggcatgacccgtggcgcgggctcgttcaagacggcgctacacgtcctgggcgtcatc
gacagcaacgcgatctcgctgccgctgcgcgccctcgacgatgccgagtcgggccgggtg
cgcgaggtcctcgagtcggtgggactgctctga

DBGET integrated database retrieval system