KEGG   Intrasporangium calvum: Intca_0950Help
Entry
Intca_0950        CDS       T01385                                 

Definition
dihydrodipicolinate synthetase
Orthology
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
ica  Intrasporangium calvum
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Intca_0950
  Amino acid metabolism
   00300 Lysine biosynthesis
    Intca_0950
Enzymes [BR:ica01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     Intca_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049557..1050489
Genome map
AA seq 310 aa AA seqDB search
MTTATPFHGLVPPVVTPLGEDLTVDVASLERLVARMIDAGVDGLFALGSSGETVLLDDAQ
RDLALEVIVKTADGRVPVIAGAIEPGTARSVQRARAAERLGAQAVVATAPFYVIVGPHEI
ERHFRSVAAAVDVPLFAYDIPVCVHSKLSNDLVLRLAHDGVIAGVKDSSGDDVGFRQLLV
QVAAEGLSDFATLTGHEVMVDSMLLAGASGSVPGLANVDPAGYARLHAAVAAGDVAAARA
EQERLIQLFRIVDAADPATSAGMTRGAGSFKTALHVLGVIDSNAISLPLRALDDAESGRV
REVLESVGLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcaacacccttccatggcctcgtgccgccggtcgtcaccccgctgggcgag
gacctgaccgtcgacgtcgcctcgctcgagcgcctcgtggcccggatgatcgacgcgggc
gtcgacgggctcttcgccctcggcagcagcggcgagaccgtcctcctcgacgacgcgcag
cgcgacctcgccctcgaggtcatcgtcaagaccgcagacggacgggtgccggtcatcgcc
ggcgccatcgagccgggcacggcccggtcggtccagcgcgcccgcgccgccgagcggctc
ggcgcccaggcggtggtggccacggcgcccttctacgtcatcgtcggcccgcacgagatc
gagcggcacttccgctccgtcgcggccgccgtcgacgtgccgttgttcgcctacgacatc
ccggtctgcgtccactccaagctctcgaacgacctcgtcctgcgcctcgcgcacgacggt
gtcatcgcgggtgtcaaggactcgagcggcgacgacgtcggcttccggcagctcctcgtc
caggtggccgcggaagggctgtccgacttcgccaccctgaccggccacgaggtgatggtc
gactcgatgctcctcgcgggcgcgagcggctccgtgcccgggctggccaacgtcgacccc
gccggctacgcccgcctgcacgcggcggtcgcggccggcgacgtcgcggcggcccgtgcc
gagcaggagcgcctcatccagctgttccggatcgtcgacgcagccgacccggccacctct
gccggcatgacccgtggcgcgggctcgttcaagacggcgctacacgtcctgggcgtcatc
gacagcaacgcgatctcgctgccgctgcgcgccctcgacgatgccgagtcgggccgggtg
cgcgaggtcctcgagtcggtgggactgctctga

DBGET integrated database retrieval system