KEGG   Intrasporangium calvum: Intca_0950Help
Entry
Intca_0950        CDS       T01385                                 

Definition
dihydrodipicolinate synthetase
Orthology
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
ica  Intrasporangium calvum
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ica01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ica00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049557..1050489
Genome map
AA seq 310 aa AA seqDB search
MTTATPFHGLVPPVVTPLGEDLTVDVASLERLVARMIDAGVDGLFALGSSGETVLLDDAQ
RDLALEVIVKTADGRVPVIAGAIEPGTARSVQRARAAERLGAQAVVATAPFYVIVGPHEI
ERHFRSVAAAVDVPLFAYDIPVCVHSKLSNDLVLRLAHDGVIAGVKDSSGDDVGFRQLLV
QVAAEGLSDFATLTGHEVMVDSMLLAGASGSVPGLANVDPAGYARLHAAVAAGDVAAARA
EQERLIQLFRIVDAADPATSAGMTRGAGSFKTALHVLGVIDSNAISLPLRALDDAESGRV
REVLESVGLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcaacacccttccatggcctcgtgccgccggtcgtcaccccgctgggcgag
gacctgaccgtcgacgtcgcctcgctcgagcgcctcgtggcccggatgatcgacgcgggc
gtcgacgggctcttcgccctcggcagcagcggcgagaccgtcctcctcgacgacgcgcag
cgcgacctcgccctcgaggtcatcgtcaagaccgcagacggacgggtgccggtcatcgcc
ggcgccatcgagccgggcacggcccggtcggtccagcgcgcccgcgccgccgagcggctc
ggcgcccaggcggtggtggccacggcgcccttctacgtcatcgtcggcccgcacgagatc
gagcggcacttccgctccgtcgcggccgccgtcgacgtgccgttgttcgcctacgacatc
ccggtctgcgtccactccaagctctcgaacgacctcgtcctgcgcctcgcgcacgacggt
gtcatcgcgggtgtcaaggactcgagcggcgacgacgtcggcttccggcagctcctcgtc
caggtggccgcggaagggctgtccgacttcgccaccctgaccggccacgaggtgatggtc
gactcgatgctcctcgcgggcgcgagcggctccgtgcccgggctggccaacgtcgacccc
gccggctacgcccgcctgcacgcggcggtcgcggccggcgacgtcgcggcggcccgtgcc
gagcaggagcgcctcatccagctgttccggatcgtcgacgcagccgacccggccacctct
gccggcatgacccgtggcgcgggctcgttcaagacggcgctacacgtcctgggcgtcatc
gacagcaacgcgatctcgctgccgctgcgcgccctcgacgatgccgagtcgggccgggtg
cgcgaggtcctcgagtcggtgggactgctctga

DBGET integrated database retrieval system