KEGG   Intrasporangium calvum: Intca_1011Help
Entry
Intca_1011        CDS       T01385                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ica  Intrasporangium calvum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Intca_1011
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Intca_1011
Enzymes [BR:ica01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Intca_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1119510..1120817)
Genome map
AA seq 435 aa AA seqDB search
MIRSRRNARSSAAAALLVLVATVAAACAGPGSPPLPVAPSGATSPPGAATTSAGTGSLSS
APTATSATSGPAATTSSPAPTRQTSEGCARTIVADLTPAQLAGQLIMVGLAADARQDSLD
ALIRDRHLGGVILLGGWYNGVERTRAATRHLNAASDRSGGAPGLLLAADQEGGNVQQLRG
DGFARMPSALEQGTLSAVALRQRASTWGEQLRAGGINVNLAPVADTVPDSLGRDNDPIGR
WDRQFSSDPDVVARMVGAFVTGMHEGKVATATKHFPGIGRITGNTDLTTDGIVDRTTTAT
DPFLEPFASGISAGTDLVMVGSAVYSRIDPGVQALFSPRIVTDLLRGRLGFRGVVITDDV
GAAKAVEDTPVGQRATRFVEAGGDIVLTARPSTVPTMHRALTGRMKADRGFRATVTAAAT
RVLTLKADLGLIGCD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgttcccgccgcaacgcgcggtcgtccgccgctgcggccctgctcgtcctcgtg
gcgacggtggctgcggcgtgcgcgggcccggggagccctccgctcccggttgcccccagc
ggagcgacgtcgcctccgggtgctgccaccacgtcagcgggcaccggcagcctctcctcc
gcaccgaccgcgacctcggcgacctcggggcccgccgcgaccacgtcctcgcccgcgccg
acccgacagacgtccgaggggtgcgcccggaccatcgtcgcggacctgacgccggcacag
ctcgcgggccagctcatcatggtcgggctcgctgcggacgcccggcaggacagcctcgac
gccctgatccgggaccggcacctcgggggcgtcatcctcctcggtggctggtacaacggc
gtggagcgcacccgtgctgcgacgcgccacctcaacgccgcctcggaccgctcgggaggc
gcaccgggcctgctcctcgccgcggaccaggagggcggcaacgtccagcagctccgcggc
gacggcttcgcccggatgccgagcgccctcgagcagggcacgctgtccgcggtcgcgctc
aggcaacgggcctccacgtggggcgagcagctgcgcgccggcggcatcaacgtcaacctc
gcccctgtcgccgacacggtccccgacagcctcggccgcgacaacgatccgatcggccgg
tgggaccggcagttctcgtcggacccggacgtcgtggcccggatggtgggggccttcgtc
accggaatgcacgagggaaaggtcgccacggcgacgaagcactttccgggcatcggccgg
atcacggggaacaccgacctgacgaccgatggcatcgtcgatcggaccacgaccgcgacc
gacccgttcctcgagccgttcgcgagcggcatctcggccggcaccgacctggtcatggtc
gggtcggcggtctacagccggatcgaccccggcgtgcaggcgctcttctccccacggatc
gtcaccgacctgctccgtggacggctgggcttccgcggggtcgtcatcaccgatgacgtg
ggggcagccaaggccgtcgaagacactcccgtgggacagcgggcgacacggttcgtcgag
gcagggggcgacatcgtcctcacggcgcgccccagcacggtcccgacgatgcatcgcgcc
ctgaccgggcggatgaaggccgaccgaggcttccgggccacggtgaccgcggcggccacc
cgggtcctgacgctcaaggccgacctggggctcatcggctgcgactga

DBGET integrated database retrieval system