KEGG   Intrasporangium calvum: Intca_1013Help
Entry
Intca_1013        CDS       T01385                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ica  Intrasporangium calvum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Intca_1013
Enzymes [BR:ica01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Intca_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1121887..1122711
Genome map
AA seq 274 aa AA seqDB search
MGRVAVLGSLNVDVVTRVTRLPRPGETVLGEAAGRFAGGKGGNQAMAARRAGADVVMIGR
VGGDDAGARYVERLRRHGIRAEVPAFPDAPTGTAYITVDDAGENSIIVVPGANEMVTDES
VTAATLGPGDVLLCSLEVPLHLVARAASAADRAGARVVLNLAPYAPLPRHVIALADPVVV
NESEMRQLADSDLIPASLLVTFGPAGARWDGEEVSGIRLDEGDVVDTVGAGDAFCGALAA
ALAGGATRREALEAANRAGAEAVQWAGAQPDAAL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgcgtcgccgtcctcggctccctcaacgtcgacgtcgtgacccgggtgacgcgc
ctgccgcggcccggcgagacggtcctcggtgaggccgccggccgcttcgccgggggaaag
ggcggcaaccaggccatggcggcccggcgcgccggcgcggacgtcgtcatgatcggacgt
gtcggcggcgacgacgcgggtgcccgctacgtcgagaggctgcgccggcacgggatccgg
gcggaggtcccggccttcccggatgccccgacgggcacggcctacatcaccgtcgacgac
gccggcgagaactccatcatcgtcgtgcccggtgccaacgagatggtcacggacgagtcg
gtcacggccgcgacactcggtcccggggacgtcctcctgtgctcgctcgaggtccccctc
cacctcgtcgcccgagccgcatcggccgccgaccgggccggcgcccgcgtcgtcctcaac
ctggcgccctacgctccgttgccgcgccacgtcatcgcactcgccgacccggtcgtggtc
aacgagtcggagatgcggcagctggccgactcggacctcatcccggcctcgctgctcgtg
acgttcggacccgcgggggccaggtgggacggggaggaggtgagcggcatacggctcgat
gagggcgacgtcgtggacacggtcggtgccggcgacgccttctgcggcgctctggcagca
gcgctcgcagggggagcgacgcgtcgggaggccctggaggcggccaatcgggcgggagcc
gaggccgtgcagtgggccggggcccagcctgacgcagccctgtga

DBGET integrated database retrieval system