KEGG   Intrasporangium calvum: Intca_1023Help
Entry
Intca_1023        CDS       T01385                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ica  Intrasporangium calvum
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Intca_1023
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Intca_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1132011..1133696
Genome map
AA seq 561 aa AA seqDB search
MTQAYDHDIVVIGSGFGGSVAALRLAEKGYRVHVYEAGRRFADEDFAETSWNLRRYLWAP
RLGCYGVQRIHRLPHCLVLAGAGVGGGSLNYANTLYIPPEPFFRDPQWAGITDWQGELAP
HYATAQRMLGVVENPCEGRVEQLMRDTANDLGVGRTFRKTPVGVFFGEPGKRVPDPYFGG
QGPDRAGCTECGNCMVGCKVGAKNTLVKNYLALAERRGVTIEPLRTVTALRPLDPARPET
GYAVTTVRSGAWTSRGKAARTVTAAQVVIAAGAWGTAELLQTMKTTDLPRLSPRLGELTR
TNSEALGGAMTTRVPDGIDLTKGVAITSSFHINDTTHVENVRYGKGSNAMGFLAIMQVDG
GGRLPRWLRFLGLAVQRPHVFLRSLSKRRWSERSVIALVMQTTDNSIRVSRKRGLLGAHL
TSSDGHGTPSPTYIPEGNAAVRAMARRLQQVTGIRAEAGSSIGEIVDIPLTAHFIGGAVI
SDTPAGGVVDPYHRVWSYPGLHVVDGAAISANLGVNPSLTITAMAERALSLWPAKGQPDP
RPEQGRAYERLVAEPPVPAGT
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcgtacgaccacgacatcgtggtgatcggatcgggtttcggcgggtcggtg
gcggccctccggctggccgagaagggctaccgggtccacgtgtacgaggccggtcggcgg
ttcgccgacgaggacttcgccgagaccagctggaacctgcgacgctacctctgggctccg
cgcctcggctgctacggggtccagcgcatccaccgcctgccgcactgcctcgtgctggcg
ggtgcgggagtcggtgggggttcgctcaactacgcgaacacgctctacatcccgccggag
ccgttcttccgggacccccagtgggcgggcatcacggactggcagggggagctggcccct
cactacgccaccgcccagcggatgctcggcgtcgtcgagaacccctgtgagggtcgtgtc
gaacagctgatgcgtgacaccgccaacgacctgggcgtcggtcggaccttccgcaagacc
cccgtcggggtcttcttcggcgagccgggcaagcgggtcccggatccgtacttcgggggg
cagggccccgaccgcgccgggtgcaccgagtgcggcaactgcatggtcgggtgcaaggtc
ggcgccaagaacaccctcgtcaagaactacctggcactcgccgagcgacgcggggtcacc
atcgagccgctccggaccgtgaccgctctgcgcccgctcgaccccgcccgccccgagacc
ggctacgccgtgaccacggtgcgatccggcgcgtggacgagccgcggcaaggcggcccgc
acggtcaccgcggcccaggtggtcatcgccgccggggcgtgggggacggccgagctcctc
cagacgatgaagacgaccgacctgccccggctctcgccgcggctcggcgagctgacccgg
accaactccgaggcgctcggcggggccatgacgacgcgcgtccccgacgggatcgacctg
accaagggagtggcgatcacctcgagcttccacatcaacgacacgacccacgtcgagaac
gtccgctacggcaaggggtccaacgcgatgggtttcctcgcgatcatgcaggtcgacgga
ggtggacggttgcctcgctggctcaggttcctcggcctggcagtccaacggccccacgtc
ttcctgcgcagcctctcgaagcgccgatggagcgagcggagcgtcatcgccctcgtcatg
cagacgacggacaactcgatccgggtgtcacgcaaacgcggcctgctcggggcgcacctg
acgtcgagcgacggacatggcacccccagcccgacgtacatccccgaggggaacgcggcc
gtgcgcgcgatggcccgtcggttgcagcaggtgaccggcatccgcgccgaggcgggctcg
tcgatcggcgagatcgtcgacatcccactgacggcgcacttcatcggcggtgcggtcatc
tccgacacgccggccggcggcgtcgtcgacccctaccaccgggtgtggagctaccccggc
ctgcacgtcgtcgacggcgcggccatctccgcgaacctcggagtcaaccccagcctgacc
atcaccgcgatggccgagcgggccctgtccctgtggccggcgaagggccagcctgacccg
cgcccggaacagggccgcgcctacgagcggctcgtcgcggaaccaccggtcccagcgggc
acctga

DBGET integrated database retrieval system