KEGG   Intrasporangium calvum: Intca_1036Help
Entry
Intca_1036        CDS       T01385                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ica  Intrasporangium calvum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Intca_1036
Enzymes [BR:ica01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Intca_1036
Peptidases [BR:ica01002]
 Cysteine Peptidases
  Family C44
   Intca_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144870..1147545
Genome map
AA seq 891 aa AA seqDB search
MCGIAGYLGIEADEALLQRMNDCQVHRGPDGDGLFTDGPVGLAHRRLSIIDRAHGQQPMT
TRDGRFTIVYNGEVYNYLPLRAELEGLGHTFTTDSDTEVVLQSFAQWGAEAFDRFNGMFG
LAIWDAQERSLTLARDHFGIKPVYVCRSAGSGAGGADAWLFASEIKPILASGRYERRPNE
RTIYRYLRFRIHEDGRETFFDGIERLEPGEVMTIAEDGTVERRPFTRLREELLELAREQR
PYDEAAAREYRDRLTEAVRLRLQSEVPVGTSLSGGLDSSAVAVIINRLLNEHDRTAESVG
AQQNTFSAVFPGSINDEERYVDDVLEICKGHVAGHKITPTPTEFKEDLADFVRTQEEPLI
SSGPYAQYQVMREATKHVTVLLDGQGADEMMAGYIPYYFVYLRQLRAQGALRAAAELSKS
LDVLYRLGRFKLKAKLRGRKSIPTTQLLAKGFVAAHAGERYTVEGSNLKKRLVEDLFVGS
LPSLLRYEDKNTMRFSLEGRVPFLDKEVVKYIFSLSDEAIIKDGWNKRILRDATRDLLPE
SINRRRNKIGFTTPQGEWFMRLKNHFYGIFLSESFAARPYFDQTEVLHAFEGWIKGTNDV
DSMTFWRLLNLELWLQEYFDEKVDEAAQGSVSRVKTDYEPNARKQLDLTLDDGQVVRRYP
LRTELYAREDDLDSKTLGYIDRFFAGLPEAGADHEVATKGTWYFFISEKIVAITQGRSYF
IWDIKVSRPARILSRYVTRTPAGIGLGSPFTMQLAIEEAGLARVLYASAGGAVGKLVGRR
GLFYDLVGGDIRAIDGPTEYSVYPANVSAKLAPKDPDQVAARLSAAIRERVPAPWRDTFG
GTVVMDANDIGRNVLGTDAPGLKERYEAMFADNPLGQGSEQTPMAIVFELT
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgcgggttatctcggaatcgaggcggacgaggcgctcctgcagcggatg
aacgactgccaggtccaccggggacccgacggggacggcctcttcaccgatggtcccgtg
gggctcgcccaccggcgcttgtcgatcatcgaccgcgcacacggccagcagccgatgacg
acccgcgacgggcggttcaccatcgtctacaacggcgaggtctacaactacctgccgctg
cgcgcggagctcgaggggctcgggcacaccttcacgacggacagcgacacggaggtcgtc
ctccagtcgttcgcgcagtggggcgccgaggcgttcgaccgcttcaacgggatgttcggc
ctcgccatctgggacgcgcaggagcggtcgctgacgctcgctcgcgaccacttcgggatc
aaacccgtttacgtatgccgctcagctggctcgggtgccggcggcgcggacgcgtggttg
ttcgcttcggagatcaagcccatcctcgcgtcgggccgctacgagaggcggccgaacgag
cgcaccatctaccgctacctgcgcttccggatccacgaggacggccgggagaccttcttc
gacgggatcgagcggctcgagcctggcgaggtcatgaccattgccgaggacgggaccgtc
gaacgccggcccttcacccggctccgcgaggagctgctcgagctcgctcgggagcagcgg
ccctacgacgaggcggccgcgcgcgagtaccgtgaccggctcaccgaggccgtccggctg
cggctgcagtcggaggtgccggtcgggacctcgctgtccggggggctcgactcgtcggcc
gtcgccgtcatcatcaaccggctgctcaacgagcacgaccggacagcggagtccgttggg
gcgcagcagaacacgttctccgctgtctttcccggctcgatcaacgacgaggaacgctac
gtcgacgacgtcctcgagatctgcaagggacacgtcgccgggcacaagatcacgccgacg
ccgacggagttcaaggaggacctcgccgacttcgtgcgcacccaggaggagccgctcatc
tcgagtggcccctacgcgcagtaccaggtgatgcgcgaggcgacgaagcacgtcaccgtc
ctcctcgacggtcagggcgccgacgagatgatggccggctacatcccgtactacttcgtc
tacctgcggcagctgcgggcccagggtgcgctcagggcggcggcggagctgtcgaagtcc
ctcgacgtcctctaccggctcggacggttcaagctcaaggcgaagctgcgtgggcgcaag
agcatcccgacgacccagctcctcgcaaaggggttcgtcgccgcgcacgcgggggagcgc
tacaccgtcgaggggagcaacctcaagaagcggctcgtcgaggacctcttcgtcggctcg
ctgccctcactgctgcgctacgaggacaagaacaccatgcggttctccctcgaagggcgc
gtgccgttcctcgacaaggaggtcgtcaagtacatcttctcgctgtccgacgaggccatc
atcaaggacggctggaacaagcggatcctcagggacgccacgcgcgacctgctgcccgag
tcgatcaaccggcgccgcaacaagatcggcttcacgaccccgcagggcgagtggttcatg
cggctcaagaaccacttctacggcatcttcctgtccgagtccttcgcggcgcggccctac
ttcgaccagaccgaggtcctgcacgcgttcgagggctggatcaagggcaccaacgacgtc
gattcgatgacgttctggcggctgctcaacctcgagctgtggctccaggagtacttcgac
gagaaggttgacgaggcggcgcaggggtccgtcagtcgcgtcaagaccgactacgaaccc
aacgcccgcaagcagctcgacctcacccttgacgatgggcaggtcgtgcgccggtacccc
cttcgcaccgagctctacgcccgcgaggacgacctcgacagcaagaccctcggctacatc
gaccggttcttcgcgggactgcccgaggcgggcgccgaccacgaggtcgccacgaagggc
acgtggtacttcttcatctcggagaagatcgtcgccatcacccaggggcgctcgtacttc
atctgggacatcaaggtctcccggcccgcgcggatcctgtcgcgctacgtgacccgaaca
cctgccggcatcggcctcgggtcacccttcacgatgcagctcgccatcgaggaggccggc
ttggctcgcgtgctctacgcgtcggccggtggcgcggtcggcaagctcgtcggtcgccgg
gggctgttctacgacctggtcggcggtgacatccgcgccatcgacggaccgaccgagtac
tccgtgtacccggccaacgtctcggccaagctggctccgaaggacccggaccaggtggcg
gcccggctgtccgcggcgatccgcgagcgggtgccggcgccatggcgggacaccttcggc
gggacggtcgtcatggacgccaacgacatcggccgcaacgtcctcggcacggacgcgccg
ggcctcaaggagcggtacgaggcgatgttcgccgacaacccgctcgggcagggctcggag
cagacgccgatggcgatcgtcttcgagctgacctga

DBGET integrated database retrieval system