KEGG   Intrasporangium calvum: Intca_1062Help
Entry
Intca_1062        CDS       T01385                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ica  Intrasporangium calvum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Intca_1062
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Intca_1062
   00640 Propanoate metabolism
    Intca_1062
   00660 C5-Branched dibasic acid metabolism
    Intca_1062
Enzymes [BR:ica01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Intca_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1171773..1172963
Genome map
AA seq 396 aa AA seqDB search
MDLFEYQARDMFEAHGVPVLAGAIATTPEEARAAAERIGQSSGGVTVVKAQVKTGGRGKA
GGVKVATSADEAQAHAEQILGMDIKGHTVHRVMIAQGAKIAEEYYFSILLDRANRSYLAM
CSKEGGMDIEQLAVERPDALAKVAVDPNVGIDEAKAREIVDAAGFDPETAAKIVPVLGRL
WEVYRDEDATLVEVNPLVKTEDGEIIALDGKVSLDANAGFRHPDHEALEDKTAADPFEAE
AKEKDLNYVRLEGSVGIIGNGAGLVMSTLDVVAYAGSEIDSVRGPKPANFLDIGGGASAE
VMANGLHIILSDPQVKSVFVNVFGGITSCDAVANGIVGALDALGTEEDRPLVVRLDGNNV
EEGRRILAERNHPRVIIEETMDGAARKAAELAAAAN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcttcgagtaccaagcgcgcgacatgttcgaggcgcacggcgtcccggttctc
gccggcgccatcgccaccacccccgaagaggcgcgcgcagccgccgaacgaatcgggcag
agctccggcggcgtcacggtcgtcaaggcccaggtcaagacgggtggccgcggcaaggcc
ggcggcgtcaaggtcgccacgtccgccgacgaggcccaggcgcacgccgagcagattctc
ggcatggacatcaagggccacaccgtccaccgggtgatgatcgcccagggtgccaagatc
gccgaggagtactacttctcgatcctgctcgaccgcgccaaccgcagctacctcgccatg
tgctccaaggagggcgggatggacatcgagcagctcgcggtggagcggcccgatgcgctg
gcgaaggttgccgtcgacccgaacgtcggcatcgacgaggccaaggcccgcgagatcgtc
gacgcagccggcttcgaccccgagaccgccgccaagatcgtccccgtcctcggccggctg
tgggaggtctaccgcgacgaggacgcgacgctcgtcgaggtcaacccgctcgtcaagacc
gaggacggcgagatcatcgccctcgacggcaaggtcagcctggacgccaacgccggcttc
cgccaccccgaccacgaggcactcgaggacaagacggccgccgaccccttcgaggcggag
gcgaaggagaaggacctcaactacgtgcggctcgagggctcggtcggcatcatcggcaac
ggcgcgggcctcgtcatgagcacgttggatgtcgtcgcctacgccggttctgagattgac
agcgttcggggtccgaaacccgccaacttcctcgacatcgggggcggcgcgagcgccgag
gtgatggccaacggcctccacatcatcttgtcggacccccaggtcaagagcgtcttcgtc
aacgtcttcgggggcatcacctcctgtgacgcggtcgcgaacggcatcgtcggcgccctc
gacgcgctgggcaccgaggaggaccggccgctcgtcgtccggctcgacggcaacaacgtc
gaggaggggcgccggatcctcgctgagcgcaaccacccgcgcgtgatcatcgaagagacc
atggacggcgcggcgcgcaaggcggccgagctcgccgcggccgcgaactga

DBGET integrated database retrieval system