KEGG   Intrasporangium calvum: Intca_1175Help
Entry
Intca_1175        CDS       T01385                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ica  Intrasporangium calvum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ica00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ica00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1310677..1311276
Genome map
AA seq 199 aa AA seqDB search
MEIRSLTIAGAFEVTPRQFHDDRGTFAEGFRADRLAEALGHEMRVRQTNISVSQAGALRG
IHFAALPPSQAKFVTVTSGVFLDFVIDIRVGSPTFGQWDSVRLDAVDRRAVYVAEGLGHA
LACLEDGVAVYLCSEVFNPAAERGVNPLDPAVGLALPEGFVPVVSDKDAAAPTLEAAAER
GELPTFEQYLAHTASLAGH
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtggagatccgatctctgaccatcgctggtgccttcgaggtcacacctcgccagttccac
gacgatcgcggaacctttgccgagggcttccgggcagaccggttggccgaggcgctcggc
catgagatgcgcgtccggcagacgaacatctcggtgtcgcaggcgggcgccctccgcggc
atccacttcgccgccctcccgccgtcccaggccaagttcgtcacggtgacgagtggcgtc
ttcctggacttcgtcatcgacatccgcgtgggttccccgaccttcgggcagtgggacagc
gtccggctcgacgccgtcgaccggcgcgcggtctacgtcgcggaaggccttggccatgcg
ctcgcgtgcctcgaggacggcgtcgccgtctacctctgttcggaggtcttcaacccggcg
gccgagcgcggcgtcaacccgctcgaccccgcggtgggcctggccctgccggaggggttc
gtccccgtcgtctccgacaaggacgcggcagcgccgaccctggaggcggcggcggagcgg
ggcgagctgccgacgttcgagcagtacctcgcccacaccgcctccctcgccggacactga

DBGET integrated database retrieval system