KEGG   Intrasporangium calvum: Intca_1226Help
Entry
Intca_1226        CDS       T01385                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ica  Intrasporangium calvum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Intca_1226
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Intca_1226
   00020 Citrate cycle (TCA cycle)
    Intca_1226
   00620 Pyruvate metabolism
    Intca_1226
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Intca_1226
   00280 Valine, leucine and isoleucine degradation
    Intca_1226
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Intca_1226
Exosome [BR:ica04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Intca_1226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373695..1375182
Genome map
AA seq 495 aa AA seqDB search
MATARKVASAGTEPSGIRLRRWLDGRVITRETSVVIIGGGPGGYEAALVGAQLGADVTII
ERLGLGGAAVLTDCVPSKALIATADYMSDFEVAGGLGVHLTDHEGDVVEDVVAQPQLVNE
RILSLAAAQSEDIHGSLTDVGVRFIRGAGRVTARDRVVARPDAPDEATQELAADVILVAT
GATPRILPSAVPDGERILTWQQIYSLTELPERLVVIGSGVTGAELAQAFLGLGSQVVLVS
SRDHVLPGEDTDAATVIEEVFRKRGMEVLSRARAAGVDRTESGVVVRLEDGRTVVGSHAL
LAVGAIPATRGLGLEEVGVDLTDSGHITVDRVSRTSVPGIYAAGDCTGVLPLASVAAMQG
RIAMWHALGDAVTPLNVQGVAATIFTEPEIATVGIGQVAADAEPDVESVMLPLARNPRAK
MQGITDGFVKLFCRKGYGTILGGVVVAPKASELIHPVALAVQNRLNVDQVASTITVYPSL
SGSIAEAARQLHQSQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccacggcccggaaggtggcttctgccgggaccgagcccagcggcatacggctgcgt
cggtggttggatggacgggtgatcacccgagagacgtccgttgtcatcatcggaggcggc
cccggcggctacgaggcggcgctcgtcggcgcccagctcggcgccgacgtcaccatcatc
gaacgcctgggactcggcggtgcggccgtgctcaccgactgcgtgccgagcaaggcgctg
atcgccacggctgactacatgtccgacttcgaggtggccggcgggctcggtgtccacctc
accgaccacgagggcgacgtggtcgaggacgtcgtcgcccaaccccagctggtcaacgag
cggatcctctcgctcgccgcggcccagagcgaggacatccacggaagcctgaccgacgtc
ggcgtgcggttcatccgcggcgccggtcgggtgacagccagggaccgggtggtcgcccga
cccgacgcgccggacgaggcgacccaggagctcgccgccgacgtcatcctcgtcgccacc
ggcgcgacgccccgcatcctgccctcggccgtgcccgacggggagcgcatcctcacctgg
cagcagatctactcgctgaccgagctgcccgagcgcctcgtcgtgatcggctccggcgtc
accggcgccgagctggcccaggccttcctcgggctcggctctcaggtcgtgctcgtctcc
tcccgcgaccacgtcctgcccggggaggacaccgacgccgccacggtgatcgaggaggtc
ttccgcaaacgcggtatggaggtgctcagccgggcccgcgcagccggggtcgaccgcacc
gagagcggagtcgtcgtccgcctcgaggacggccggaccgtggtcggcagtcacgcgctg
ctcgccgtgggagcgatccccgcgacccgtggcctcggtctcgaggaggtcggcgtcgac
ctcaccgactcgggccacatcaccgtcgaccgcgtctcgcggacgtccgtcccggggatc
tacgccgcaggcgactgcaccggcgttctcccgctcgcgtcggtcgcggcgatgcagggc
cggatcgcgatgtggcacgcactgggcgacgccgtcacacccctcaatgtccaaggggtc
gccgcgacgatcttcacggagcccgagatcgcgacggtcggcatcgggcaggtggccgcg
gacgccgagcccgacgtcgagtccgtcatgcttccgctggcgcgcaacccccgggccaag
atgcaggggatcaccgacggcttcgtcaagctgttctgccgcaagggctacgggacgatc
ctgggtggggtcgtcgtcgcgccgaaggcgtccgagctgatccacccggtcgcgctcgcc
gtccagaaccgcctcaacgtcgaccaggtggccagcaccatcaccgtctacccgtcgctc
tcgggctcgatcgcggaagccgcgcggcagctccaccagtcgcagtga

DBGET integrated database retrieval system