KEGG   Intrasporangium calvum: Intca_1226Help
Entry
Intca_1226        CDS       T01385                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ica  Intrasporangium calvum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ica01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ica00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ica00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ica00620]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ica00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ica00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373695..1375182
Genome map
AA seq 495 aa AA seqDB search
MATARKVASAGTEPSGIRLRRWLDGRVITRETSVVIIGGGPGGYEAALVGAQLGADVTII
ERLGLGGAAVLTDCVPSKALIATADYMSDFEVAGGLGVHLTDHEGDVVEDVVAQPQLVNE
RILSLAAAQSEDIHGSLTDVGVRFIRGAGRVTARDRVVARPDAPDEATQELAADVILVAT
GATPRILPSAVPDGERILTWQQIYSLTELPERLVVIGSGVTGAELAQAFLGLGSQVVLVS
SRDHVLPGEDTDAATVIEEVFRKRGMEVLSRARAAGVDRTESGVVVRLEDGRTVVGSHAL
LAVGAIPATRGLGLEEVGVDLTDSGHITVDRVSRTSVPGIYAAGDCTGVLPLASVAAMQG
RIAMWHALGDAVTPLNVQGVAATIFTEPEIATVGIGQVAADAEPDVESVMLPLARNPRAK
MQGITDGFVKLFCRKGYGTILGGVVVAPKASELIHPVALAVQNRLNVDQVASTITVYPSL
SGSIAEAARQLHQSQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccacggcccggaaggtggcttctgccgggaccgagcccagcggcatacggctgcgt
cggtggttggatggacgggtgatcacccgagagacgtccgttgtcatcatcggaggcggc
cccggcggctacgaggcggcgctcgtcggcgcccagctcggcgccgacgtcaccatcatc
gaacgcctgggactcggcggtgcggccgtgctcaccgactgcgtgccgagcaaggcgctg
atcgccacggctgactacatgtccgacttcgaggtggccggcgggctcggtgtccacctc
accgaccacgagggcgacgtggtcgaggacgtcgtcgcccaaccccagctggtcaacgag
cggatcctctcgctcgccgcggcccagagcgaggacatccacggaagcctgaccgacgtc
ggcgtgcggttcatccgcggcgccggtcgggtgacagccagggaccgggtggtcgcccga
cccgacgcgccggacgaggcgacccaggagctcgccgccgacgtcatcctcgtcgccacc
ggcgcgacgccccgcatcctgccctcggccgtgcccgacggggagcgcatcctcacctgg
cagcagatctactcgctgaccgagctgcccgagcgcctcgtcgtgatcggctccggcgtc
accggcgccgagctggcccaggccttcctcgggctcggctctcaggtcgtgctcgtctcc
tcccgcgaccacgtcctgcccggggaggacaccgacgccgccacggtgatcgaggaggtc
ttccgcaaacgcggtatggaggtgctcagccgggcccgcgcagccggggtcgaccgcacc
gagagcggagtcgtcgtccgcctcgaggacggccggaccgtggtcggcagtcacgcgctg
ctcgccgtgggagcgatccccgcgacccgtggcctcggtctcgaggaggtcggcgtcgac
ctcaccgactcgggccacatcaccgtcgaccgcgtctcgcggacgtccgtcccggggatc
tacgccgcaggcgactgcaccggcgttctcccgctcgcgtcggtcgcggcgatgcagggc
cggatcgcgatgtggcacgcactgggcgacgccgtcacacccctcaatgtccaaggggtc
gccgcgacgatcttcacggagcccgagatcgcgacggtcggcatcgggcaggtggccgcg
gacgccgagcccgacgtcgagtccgtcatgcttccgctggcgcgcaacccccgggccaag
atgcaggggatcaccgacggcttcgtcaagctgttctgccgcaagggctacgggacgatc
ctgggtggggtcgtcgtcgcgccgaaggcgtccgagctgatccacccggtcgcgctcgcc
gtccagaaccgcctcaacgtcgaccaggtggccagcaccatcaccgtctacccgtcgctc
tcgggctcgatcgcggaagccgcgcggcagctccaccagtcgcagtga

DBGET integrated database retrieval system