KEGG   Intrasporangium calvum: Intca_1226Help
Entry
Intca_1226        CDS       T01385                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ica  Intrasporangium calvum
Pathway
ica00010  Glycolysis / Gluconeogenesis
ica00020  Citrate cycle (TCA cycle)
ica00260  Glycine, serine and threonine metabolism
ica00280  Valine, leucine and isoleucine degradation
ica00620  Pyruvate metabolism
ica00630  Glyoxylate and dicarboxylate metabolism
ica00640  Propanoate metabolism
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01120  Microbial metabolism in diverse environments
ica01130  Biosynthesis of antibiotics
ica01200  Carbon metabolism
Module
ica_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ica_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ica_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Intca_1226
   00020 Citrate cycle (TCA cycle)
    Intca_1226
   00620 Pyruvate metabolism
    Intca_1226
   00630 Glyoxylate and dicarboxylate metabolism
    Intca_1226
   00640 Propanoate metabolism
    Intca_1226
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Intca_1226
   00280 Valine, leucine and isoleucine degradation
    Intca_1226
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Intca_1226
Exosome [BR:ica04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Intca_1226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA AlaDh_PNT_C K_oxygenase FAD_binding_3 FAD_oxidored 2-Hacid_dh_C Thi4 3HCDH_N HI0933_like DFP Trp_halogenase FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ADU47744
UniProt: E6SFJ9
Position
1373695..1375182
Genome map
AA seq 495 aa AA seqDB search
MATARKVASAGTEPSGIRLRRWLDGRVITRETSVVIIGGGPGGYEAALVGAQLGADVTII
ERLGLGGAAVLTDCVPSKALIATADYMSDFEVAGGLGVHLTDHEGDVVEDVVAQPQLVNE
RILSLAAAQSEDIHGSLTDVGVRFIRGAGRVTARDRVVARPDAPDEATQELAADVILVAT
GATPRILPSAVPDGERILTWQQIYSLTELPERLVVIGSGVTGAELAQAFLGLGSQVVLVS
SRDHVLPGEDTDAATVIEEVFRKRGMEVLSRARAAGVDRTESGVVVRLEDGRTVVGSHAL
LAVGAIPATRGLGLEEVGVDLTDSGHITVDRVSRTSVPGIYAAGDCTGVLPLASVAAMQG
RIAMWHALGDAVTPLNVQGVAATIFTEPEIATVGIGQVAADAEPDVESVMLPLARNPRAK
MQGITDGFVKLFCRKGYGTILGGVVVAPKASELIHPVALAVQNRLNVDQVASTITVYPSL
SGSIAEAARQLHQSQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccacggcccggaaggtggcttctgccgggaccgagcccagcggcatacggctgcgt
cggtggttggatggacgggtgatcacccgagagacgtccgttgtcatcatcggaggcggc
cccggcggctacgaggcggcgctcgtcggcgcccagctcggcgccgacgtcaccatcatc
gaacgcctgggactcggcggtgcggccgtgctcaccgactgcgtgccgagcaaggcgctg
atcgccacggctgactacatgtccgacttcgaggtggccggcgggctcggtgtccacctc
accgaccacgagggcgacgtggtcgaggacgtcgtcgcccaaccccagctggtcaacgag
cggatcctctcgctcgccgcggcccagagcgaggacatccacggaagcctgaccgacgtc
ggcgtgcggttcatccgcggcgccggtcgggtgacagccagggaccgggtggtcgcccga
cccgacgcgccggacgaggcgacccaggagctcgccgccgacgtcatcctcgtcgccacc
ggcgcgacgccccgcatcctgccctcggccgtgcccgacggggagcgcatcctcacctgg
cagcagatctactcgctgaccgagctgcccgagcgcctcgtcgtgatcggctccggcgtc
accggcgccgagctggcccaggccttcctcgggctcggctctcaggtcgtgctcgtctcc
tcccgcgaccacgtcctgcccggggaggacaccgacgccgccacggtgatcgaggaggtc
ttccgcaaacgcggtatggaggtgctcagccgggcccgcgcagccggggtcgaccgcacc
gagagcggagtcgtcgtccgcctcgaggacggccggaccgtggtcggcagtcacgcgctg
ctcgccgtgggagcgatccccgcgacccgtggcctcggtctcgaggaggtcggcgtcgac
ctcaccgactcgggccacatcaccgtcgaccgcgtctcgcggacgtccgtcccggggatc
tacgccgcaggcgactgcaccggcgttctcccgctcgcgtcggtcgcggcgatgcagggc
cggatcgcgatgtggcacgcactgggcgacgccgtcacacccctcaatgtccaaggggtc
gccgcgacgatcttcacggagcccgagatcgcgacggtcggcatcgggcaggtggccgcg
gacgccgagcccgacgtcgagtccgtcatgcttccgctggcgcgcaacccccgggccaag
atgcaggggatcaccgacggcttcgtcaagctgttctgccgcaagggctacgggacgatc
ctgggtggggtcgtcgtcgcgccgaaggcgtccgagctgatccacccggtcgcgctcgcc
gtccagaaccgcctcaacgtcgaccaggtggccagcaccatcaccgtctacccgtcgctc
tcgggctcgatcgcggaagccgcgcggcagctccaccagtcgcagtga

DBGET integrated database retrieval system