KEGG   Intrasporangium calvum: Intca_1321Help
Entry
Intca_1321        CDS       T01385                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ica  Intrasporangium calvum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ica00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1478267..1478977)
Genome map
AA seq 236 aa AA seqDB search
MSDSPVPAPIPGAGPSPGAGLTPSSTPSSTPSSTPSRPAGRRRALIIVDVQNDFCEGGSL
AVAGGAAVAASIADHVEDHAGDYDAVVATADWHVDPGGHFSPSPDFVDSWPVHCVADTSG
SAFHPALAPALGSVQAVFRKGEHAAAYSGFEGRSTDAEQATLAAWLEERGVSQVDVVGIA
TDHCVRATALDARREGLETTVLLDLTAGVARTTTDAALRQLGGAGVRLTGAPRLAD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagcccagttcccgctccgatccccggtgccgggccgagccccggcgcgggc
ttgaccccgagttcgaccccgagttcgaccccgagttcgaccccgagccgacccgccggg
cgccggcgcgcgctcatcatcgtcgatgtccagaacgacttctgcgagggcggctccctt
gcggtggccggcggcgccgccgtcgcggcctccatcgcggaccacgtcgaggatcacgcc
ggcgactatgacgccgtcgtcgcgacggcagactggcatgtcgacccgggcggacacttc
tccccgtcccccgacttcgtcgactcgtggccggtgcactgcgtcgccgacacttctggc
tcggcgttccatcccgcgctcgctcccgcgctcggctcggtgcaggccgtcttccgcaag
ggcgagcacgccgccgcctacagcgggttcgaggggcgcagcaccgacgccgagcaggcg
acgctcgcggcctggctcgaggagcggggcgtctcacaggtcgatgtcgtcggcatcgcc
accgaccactgcgtccgcgccacggccctcgacgcacggcgtgaggggctggagacgacg
gtcctgctcgacctcaccgctggcgtcgccagaaccacgaccgacgcagccctcaggcag
ctcggcggggctggggtacgcctcacgggggcgccgcggctggccgactga

DBGET integrated database retrieval system