KEGG   Intrasporangium calvum: Intca_1321Help
Entry
Intca_1321        CDS       T01385                                 

Definition
(RefSeq) isochorismatase hydrolase
  KO
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ica  Intrasporangium calvum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Intca_1321
Enzymes [BR:ica01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Intca_1321
    3.5.1.-  
     Intca_1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1478267..1478977)
Genome map
AA seq 236 aa AA seqDB search
MSDSPVPAPIPGAGPSPGAGLTPSSTPSSTPSSTPSRPAGRRRALIIVDVQNDFCEGGSL
AVAGGAAVAASIADHVEDHAGDYDAVVATADWHVDPGGHFSPSPDFVDSWPVHCVADTSG
SAFHPALAPALGSVQAVFRKGEHAAAYSGFEGRSTDAEQATLAAWLEERGVSQVDVVGIA
TDHCVRATALDARREGLETTVLLDLTAGVARTTTDAALRQLGGAGVRLTGAPRLAD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagcccagttcccgctccgatccccggtgccgggccgagccccggcgcgggc
ttgaccccgagttcgaccccgagttcgaccccgagttcgaccccgagccgacccgccggg
cgccggcgcgcgctcatcatcgtcgatgtccagaacgacttctgcgagggcggctccctt
gcggtggccggcggcgccgccgtcgcggcctccatcgcggaccacgtcgaggatcacgcc
ggcgactatgacgccgtcgtcgcgacggcagactggcatgtcgacccgggcggacacttc
tccccgtcccccgacttcgtcgactcgtggccggtgcactgcgtcgccgacacttctggc
tcggcgttccatcccgcgctcgctcccgcgctcggctcggtgcaggccgtcttccgcaag
ggcgagcacgccgccgcctacagcgggttcgaggggcgcagcaccgacgccgagcaggcg
acgctcgcggcctggctcgaggagcggggcgtctcacaggtcgatgtcgtcggcatcgcc
accgaccactgcgtccgcgccacggccctcgacgcacggcgtgaggggctggagacgacg
gtcctgctcgacctcaccgctggcgtcgccagaaccacgaccgacgcagccctcaggcag
ctcggcggggctggggtacgcctcacgggggcgccgcggctggccgactga

DBGET integrated database retrieval system