KEGG   Intrasporangium calvum: Intca_1538Help
Entry
Intca_1538        CDS       T01385                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ica  Intrasporangium calvum
Pathway
ica00340  Histidine metabolism
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01230  Biosynthesis of amino acids
Module
ica_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Intca_1538
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Intca_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADU48051
UniProt: E6S8D0
Position
1732960..1734318
Genome map
AA seq 452 aa AA seqDB search
MMSTLDLRGRTLDVRFLRGALPRAEFDVTAALEQVRPICGDVEHRGADALRDLGERFDGV
RPARLRVPGEVLAAALDQLAPDLRSALEESIRRARVVHADQRRVDTTTTVVPGGTVTERW
VPVDRVGLYVPGGLAVYPSSVVMNVVPAQLAGVGSVAVTSPPQRENTGVFADYPNPTILA
TCALLGVDEVYAVGGAQAVAMFAYGFVDESDVRAGGPVRCEPVSMVTGPGNIWVVAAKRL
LKGLIGIDAEAGPTEIAVLADDTADAEHVAADLISQAEHDPLAASVLVTDSDSLAAAVAE
ALARRVPATKHAERVVTALGGRQSRIVLVDDLTAGLAVVNAYAAEHLEIHTRDAAAVAAR
VRNAGAIFVGPWAPVSLGDYAAGSNHVLPTAGCATHSSGLSVQSFLRGIHVVEYDEAALR
EVAGHVVTLAQAEDLPAHGQAVTARFGDEVPR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccaccctcgacctgcgcggtcgcacgctcgacgtgcgtttcctgcgcggggcc
ctgccccgagccgagttcgacgtcacggctgccctcgagcaggtgcggccgatctgcggg
gacgtcgagcatcggggcgccgacgcgctgcgcgacctcggggagcggttcgacggggtg
cgcccggcccgcctgcgagtgccgggcgaggtgctcgccgcggctctcgaccagctcgcg
ccggacctgcgctccgcgctcgaggagtccatccgtcgagctcgggtcgtgcacgccgac
cagcgccgcgtcgacacgacgacgaccgtggtcccgggcgggaccgtgacggagcgctgg
gtccccgtcgaccgcgtggggctgtacgttcccggcggcctcgccgtgtacccgagcagc
gtcgtcatgaatgtcgtcccggcgcagctcgccggggtcggctccgtcgccgtgacctcg
ccgccgcagcgagagaacaccggtgtcttcgccgactaccccaaccccacgatcctggcc
acgtgtgccctgctgggtgtcgacgaggtctatgccgtcggcggcgcccaggccgtcgcc
atgttcgcctacggcttcgtcgacgagtcggacgtccgggcggggggacccgttcggtgc
gagccggtgtcgatggtgaccgggccgggcaacatctgggtcgtcgccgccaagcgcctc
ctcaagggcctcatcgggatcgacgcggaggcggggccgacggagattgccgtcctggcc
gacgacacggccgacgccgagcacgtcgctgccgacctcatcagccaggcggagcacgac
ccgctagccgcctccgtgctggtcaccgacagtgactcgctcgccgcggccgtcgccgag
gccctggcccgccgggtgccggcgaccaagcacgccgagcgggtcgtcaccgcgctcggc
ggccgccagtcacggatcgtgctcgtcgacgacctcacggccggcctggcggtcgtcaac
gcctacgccgccgagcacctcgagatccacacccgagacgcggcggccgtcgcggcgcgc
gtccgcaacgccggcgcgatcttcgtcggcccctgggccccggtgagcctcggggactac
gccgccgggtcgaaccacgtgctgccgaccgcgggctgcgccacccactcgagcggcctg
tcggtccagtcgttcctccggggcatccacgtcgtcgagtacgacgaagcggccctgcgc
gaggtggccggacacgtcgtcacgctggcgcaggcggaggacctgcccgcccacgggcaa
gcggtgaccgcgcgcttcggcgacgaggtgccccgatga

DBGET integrated database retrieval system