KEGG   Intrasporangium calvum: Intca_1601Help
Entry
Intca_1601        CDS       T01385                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ica  Intrasporangium calvum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Intca_1601
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Intca_1601
Enzymes [BR:ica01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Intca_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1810977..1812011
Genome map
AA seq 344 aa AA seqDB search
MTRHMLSSADLSRTEVLDILATAESMHDLQRREVKKVPTLRGRTVINFFFEDSTRTRSSF
EIAGKWMSADTINLSAKGSSTSKGESLRDTAMTIDAMAVDALVIRHNASGACHQVAQWVR
CSVINAGDGTHEHPTQALLDAYTLRSRLGDLDGKHVVIVGDLTHSRVFRSNVITLKTLGA
RVTVVAPPTLMPSGIVGWSATDGFATSWDLDAVLDGEDPVDAVMMLRVQRERMSGGYFPT
AREYTVGYGLTRDRLDRLVARNPDVLILHPGPMNRGLEIAAEAADSARSVVLDQVSAGVA
VRMAVLYHLLAGNDDAPREPAELETSTTGASAPSAPTQPEGVAR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgactcgacacatgctctcgtcggcggacctcagccgcaccgaggtcctggacatcctc
gccacagccgagtcgatgcacgacctccagcgacgtgaggtgaagaaggtcccgaccctc
cgcggtcgcaccgtgatcaacttcttcttcgaggactcgacccgcacccgctcgtccttc
gagatcgccgggaagtggatgtccgccgacaccatcaacctctcggccaaggggtcgtcg
acctcgaagggagagagcctccgcgacaccgccatgaccatcgacgcgatggccgtggac
gccctcgtcatccgccacaacgcctccggcgcctgccaccaggtggcccagtgggtgcgc
tgctcggtgatcaacgccggagacgggacccatgagcacccgacgcaggcgctgctcgac
gcgtacacgctccggagtcgcctcggcgacctcgacggcaagcacgtcgtgatcgtcggc
gacctcacgcactcgcgcgtcttccggagcaacgtcatcacgctcaagacgctgggagcc
agagtgaccgtcgtcgcaccccccaccctgatgccgagtggcatcgtcggctggagtgcc
acggacgggttcgccacgtcgtgggacctcgacgccgtgctcgacggcgaggaccccgtg
gacgcggtcatgatgctccgggtccagcgcgaacggatgagcggcgggtacttcccgacg
gctcgggagtacaccgtcggctacggcctgacgcgagaccgcctcgaccggctcgtggcg
cgcaaccctgacgtgctcatcctgcacccgggcccgatgaaccgcgggctcgagatcgcg
gccgaggctgcggacagcgcccggtcggtcgtcctcgaccaggtctccgcgggtgtcgcc
gtccggatggcagtcctctatcacctgctcgcaggcaacgacgacgcgccgcgcgagccg
gccgagctcgagaccagcacgaccggggcgtccgcgccgtcggcccccacgcagcctgaa
ggagttgcccgatga

DBGET integrated database retrieval system