KEGG   Intrasporangium calvum: Intca_1640Help
Entry
Intca_1640        CDS       T01385                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ica  Intrasporangium calvum
Pathway
ica00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01130  Biosynthesis of antibiotics
ica01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Intca_1640
Enzymes [BR:ica01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Intca_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS DHO_dh NanE
Motif
Other DBs
NCBI-ProteinID: ADU48153
UniProt: E6S9F7
Position
1850697..1851539
Genome map
AA seq 280 aa AA seqDB search
MPTVLDEIISGVREDLAARRAATSFQQIEAMAAAAPPALDPLPVFRTAPGVAVIAEVKRR
SPSKGALADIPEPGALAAAYAAGGASAVSVLTEQRRFGGSLADLDLVRSAVSIPVLRKDF
IVDAYQVYEARAHGADLVLLMASALDDEQLSDLHDLATRLGMTPLVEVHDAAELERALAV
RPSLVGVNARNLKTLEVDRQVVADLLPLLPSDVVAVAESGVSGPADVADYVRAGAGAVLV
GEALVTGGAPAEAVAAFITAASGVRAAAAGSASAAPQDKE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacggttctcgacgagatcatcagcggcgtccgcgaggatctcgcggcccgccgc
gccgcgacgtcgttccaacagatcgaggcgatggccgcagccgccccgcccgccctcgac
ccgctgcccgtcttccggaccgcgccgggcgtcgccgtcatcgccgaggtgaagcggcgc
agcccgagcaaaggtgccctcgcggacatccccgagccgggggcgctcgccgccgcctac
gccgccggaggggccagcgcggtcagcgtcctgaccgagcagcgtcgcttcggtgggagc
ctcgccgacctcgacctggtgcgctcggccgtgtcgatcccggtgttgcgcaaggacttc
atcgtcgacgcttaccaggtgtacgaggcccgggcccacggtgcggacctcgtcctgctg
atggcctcggcgctcgacgacgagcagctgagcgacctgcacgacctcgcgacccgcctc
gggatgacgcccctcgtcgaggtgcacgacgctgccgagctcgagcgcgccctggccgtc
cgaccgtccctcgtcggcgtcaacgcccgcaacctcaagaccctcgaggtcgaccgacag
gtggtcgccgacctgcttcccctgctgccgagcgacgtcgtggcggtcgccgagtccggg
gtgtcggggccggccgacgtggcggactacgtccgggccggtgccggagccgtcctcgtc
ggcgaggccctcgtcaccggcggcgcgccggccgaggccgtggcggcgttcatcacggcc
gcgtccggggtccgggccgcagcggccggcagcgcgtcggccgcgccccaggacaaggag
tga

DBGET integrated database retrieval system