KEGG   Intrasporangium calvum: Intca_1640Help
Entry
Intca_1640        CDS       T01385                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ica  Intrasporangium calvum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Intca_1640
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Intca_1640
Enzymes [BR:ica01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Intca_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1850697..1851539
Genome map
AA seq 280 aa AA seqDB search
MPTVLDEIISGVREDLAARRAATSFQQIEAMAAAAPPALDPLPVFRTAPGVAVIAEVKRR
SPSKGALADIPEPGALAAAYAAGGASAVSVLTEQRRFGGSLADLDLVRSAVSIPVLRKDF
IVDAYQVYEARAHGADLVLLMASALDDEQLSDLHDLATRLGMTPLVEVHDAAELERALAV
RPSLVGVNARNLKTLEVDRQVVADLLPLLPSDVVAVAESGVSGPADVADYVRAGAGAVLV
GEALVTGGAPAEAVAAFITAASGVRAAAAGSASAAPQDKE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacggttctcgacgagatcatcagcggcgtccgcgaggatctcgcggcccgccgc
gccgcgacgtcgttccaacagatcgaggcgatggccgcagccgccccgcccgccctcgac
ccgctgcccgtcttccggaccgcgccgggcgtcgccgtcatcgccgaggtgaagcggcgc
agcccgagcaaaggtgccctcgcggacatccccgagccgggggcgctcgccgccgcctac
gccgccggaggggccagcgcggtcagcgtcctgaccgagcagcgtcgcttcggtgggagc
ctcgccgacctcgacctggtgcgctcggccgtgtcgatcccggtgttgcgcaaggacttc
atcgtcgacgcttaccaggtgtacgaggcccgggcccacggtgcggacctcgtcctgctg
atggcctcggcgctcgacgacgagcagctgagcgacctgcacgacctcgcgacccgcctc
gggatgacgcccctcgtcgaggtgcacgacgctgccgagctcgagcgcgccctggccgtc
cgaccgtccctcgtcggcgtcaacgcccgcaacctcaagaccctcgaggtcgaccgacag
gtggtcgccgacctgcttcccctgctgccgagcgacgtcgtggcggtcgccgagtccggg
gtgtcggggccggccgacgtggcggactacgtccgggccggtgccggagccgtcctcgtc
ggcgaggccctcgtcaccggcggcgcgccggccgaggccgtggcggcgttcatcacggcc
gcgtccggggtccgggccgcagcggccggcagcgcgtcggccgcgccccaggacaaggag
tga

DBGET integrated database retrieval system