KEGG   Intrasporangium calvum: Intca_1641Help
Entry
Intca_1641        CDS       T01385                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ica  Intrasporangium calvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Intca_1641
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Intca_1641
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Intca_1641
Enzymes [BR:ica01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Intca_1641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1851542..1852819
Genome map
AA seq 425 aa AA seqDB search
MPTPMPMPEPVGRFGRFGGRYVPEALIPALEQLEEVWRKAVVDPAFTGELERLHRTYTGR
PSIITEVPRFAEHCGGARVLLKREDLNHTGSHKINNVLGQALLTQRMGKTRVIAETGAGQ
HGVATATAAALLGLECVVYMGKKDTERQALNVARMRLLGAEVVPVEHGSQTLKDAVNEAF
RDWVANVATTHYVLGTVTGPHPFPEMVREFHRVIGIEARQQVLDLVGRLPDVVCACVGGG
SNAIGIFHRFLDDASVRLVGLEAGGSGVESGKHAARFSAGVPGVLHGAFTYVLQDEDGQT
IESHSVSAGLDYPSVGPEHALLRESGRAEYRPITDVEAMEAFRLLARTEGILPAIESAHA
LAGAMQLGRELGRDAVILVNLSGRGDKDVHTAAEWFGLIDERGTVTAPPDGADGDAGPKG
MGPQQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgcccatgcccatgccagagccggtcggacgcttcggccggttcggtggccgc
tacgtccccgaggcgctcatcccggcgctcgagcagctggaggaggtctggcgcaaggcc
gtcgtcgacccggccttcaccggcgagctcgagcggctgcaccgcacctacaccggccgg
cccagcatcatcaccgaggtgccgcggttcgccgagcactgcggcggcgcgcgcgtcctc
ctcaagcgcgaggacctcaaccacactggctcgcacaagatcaacaacgtgctcggtcag
gcgctgctcacccaacggatgggcaagacccgcgtcatcgccgagacgggagcgggccag
cacggggtggcgaccgcgaccgcagcggccctcctcggcctcgagtgcgtcgtctacatg
ggcaagaaggacaccgagcggcaggccctcaacgtggcccggatgcggctgctgggggcc
gaggtcgtcccggtcgagcacggcagccagaccctcaaggacgccgtcaacgaggcgttc
cgggactgggtcgccaacgtcgcgacgacccactacgtgctcggcaccgtcaccggtccc
cacccgttcccggagatggtccgcgagttccaccgggtgatcgggatcgaggcgagacag
caggtcctcgacctcgtcggccggctgccggacgtcgtctgcgcctgcgtgggcgggggg
tccaacgcgatcgggatcttccaccgcttcctcgacgacgcgtccgtccgcctcgtcggg
ctcgaagccggcgggtcaggcgtggagtccggcaagcatgcggcccgcttctccgccggt
gtccccggcgtgctccacggcgcgttcacctacgtcctccaggacgaggacgggcagacc
atcgagtcccacagcgtctccgcgggtctggactaccccagcgtcggtcccgagcacgca
ctgctgcgcgagtccgggcgggccgagtaccgtccgatcaccgacgtcgaggcgatggag
gcgttccgcctcctcgcccgcaccgaggggatcctcccggccatcgagagcgcgcacgcc
ctcgccggcgccatgcagctcggccgtgagctgggtcgagacgccgtcatcctcgtcaac
ctgtccggtcggggcgacaaggacgtgcacaccgcggctgagtggttcggcctgatcgac
gagcgcggcacggtgaccgcgccaccggacggggccgacggcgacgccggcccgaaggga
atgggaccgcaacagtga

DBGET integrated database retrieval system