KEGG   Intrasporangium calvum: Intca_1641Help
Entry
Intca_1641        CDS       T01385                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ica  Intrasporangium calvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Intca_1641
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Intca_1641
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Intca_1641
Enzymes [BR:ica01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Intca_1641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1851542..1852819
Genome map
AA seq 425 aa AA seqDB search
MPTPMPMPEPVGRFGRFGGRYVPEALIPALEQLEEVWRKAVVDPAFTGELERLHRTYTGR
PSIITEVPRFAEHCGGARVLLKREDLNHTGSHKINNVLGQALLTQRMGKTRVIAETGAGQ
HGVATATAAALLGLECVVYMGKKDTERQALNVARMRLLGAEVVPVEHGSQTLKDAVNEAF
RDWVANVATTHYVLGTVTGPHPFPEMVREFHRVIGIEARQQVLDLVGRLPDVVCACVGGG
SNAIGIFHRFLDDASVRLVGLEAGGSGVESGKHAARFSAGVPGVLHGAFTYVLQDEDGQT
IESHSVSAGLDYPSVGPEHALLRESGRAEYRPITDVEAMEAFRLLARTEGILPAIESAHA
LAGAMQLGRELGRDAVILVNLSGRGDKDVHTAAEWFGLIDERGTVTAPPDGADGDAGPKG
MGPQQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgcccatgcccatgccagagccggtcggacgcttcggccggttcggtggccgc
tacgtccccgaggcgctcatcccggcgctcgagcagctggaggaggtctggcgcaaggcc
gtcgtcgacccggccttcaccggcgagctcgagcggctgcaccgcacctacaccggccgg
cccagcatcatcaccgaggtgccgcggttcgccgagcactgcggcggcgcgcgcgtcctc
ctcaagcgcgaggacctcaaccacactggctcgcacaagatcaacaacgtgctcggtcag
gcgctgctcacccaacggatgggcaagacccgcgtcatcgccgagacgggagcgggccag
cacggggtggcgaccgcgaccgcagcggccctcctcggcctcgagtgcgtcgtctacatg
ggcaagaaggacaccgagcggcaggccctcaacgtggcccggatgcggctgctgggggcc
gaggtcgtcccggtcgagcacggcagccagaccctcaaggacgccgtcaacgaggcgttc
cgggactgggtcgccaacgtcgcgacgacccactacgtgctcggcaccgtcaccggtccc
cacccgttcccggagatggtccgcgagttccaccgggtgatcgggatcgaggcgagacag
caggtcctcgacctcgtcggccggctgccggacgtcgtctgcgcctgcgtgggcgggggg
tccaacgcgatcgggatcttccaccgcttcctcgacgacgcgtccgtccgcctcgtcggg
ctcgaagccggcgggtcaggcgtggagtccggcaagcatgcggcccgcttctccgccggt
gtccccggcgtgctccacggcgcgttcacctacgtcctccaggacgaggacgggcagacc
atcgagtcccacagcgtctccgcgggtctggactaccccagcgtcggtcccgagcacgca
ctgctgcgcgagtccgggcgggccgagtaccgtccgatcaccgacgtcgaggcgatggag
gcgttccgcctcctcgcccgcaccgaggggatcctcccggccatcgagagcgcgcacgcc
ctcgccggcgccatgcagctcggccgtgagctgggtcgagacgccgtcatcctcgtcaac
ctgtccggtcggggcgacaaggacgtgcacaccgcggctgagtggttcggcctgatcgac
gagcgcggcacggtgaccgcgccaccggacggggccgacggcgacgccggcccgaaggga
atgggaccgcaacagtga

DBGET integrated database retrieval system