KEGG   Intrasporangium calvum: Intca_1642Help
Entry
Intca_1642        CDS       T01385                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ica  Intrasporangium calvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Intca_1642
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Intca_1642
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Intca_1642
Enzymes [BR:ica01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Intca_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1852816..1853616
Genome map
AA seq 266 aa AA seqDB search
MSVSPIIEACRAEGRAALIGYLPVGFPSVAGSIEAMELLVRAGVDIVEIGVPYSDPVMDG
PVIQDAAVRALEGGVRLADTFAAVRAVRAAGAGALVMTYWNPVLRYGVDRFAADLAAAGG
DGLITPDLIPDEAADWIGAADEHGLDKVFLVAPSSTPERLAAVTSRSRGFVYATAVMGVT
GARSSVGDAAEDLVVRTRAVTDLPICVGLGVSTGEQASQVGRFADGVIVGSALVRCLTEA
STPASGLMALEELVRDLAAGVRRGRS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcagcccgatcatcgaggcctgccgggccgaagggcgtgcggccctcatcggc
tacctgcccgtcggcttcccgtccgtcgccggctccatcgaggcgatggagctgctggtc
cgggccggggtggacatcgtcgagatcggcgtgccctacagcgaccccgtgatggacggc
ccggtcatccaggacgccgccgttcgtgccctcgagggaggggtccgcctggcggacacc
ttcgccgcggtccgcgccgtgcgtgccgcgggcgctggagccctcgtgatgacctactgg
aacccggtgctgcgctacggcgtggaccgcttcgccgccgatctcgcggcggccggcggc
gacggcctcatcacccccgacctcatccccgacgaggcagcggactggatcggcgcggcg
gacgagcacggcctcgacaaggtgttcctcgtcgccccgagctcgacgccggagcggctg
gccgcagtgacgtcacggtcccgcggcttcgtctacgcgacggccgtcatgggcgtcacc
ggggcccggtcgagcgtcggggacgcggccgaggacctcgtcgtccgcacgagggccgtc
acggacctaccgatctgtgtcggcctcggtgtgtccaccggcgaacaggcgagtcaggtg
ggtcggttcgcggacggtgtcatcgtcgggtcggcgctcgtccggtgcctcaccgaggcg
tcgacccccgcatcagggctcatggcactcgaggagctcgtgcgcgacctcgccgcgggc
gtccggaggggacggtcgtga

DBGET integrated database retrieval system