KEGG   Intrasporangium calvum: Intca_1642Help
Entry
Intca_1642        CDS       T01385                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ica  Intrasporangium calvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ica01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ica00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ica00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1852816..1853616
Genome map
AA seq 266 aa AA seqDB search
MSVSPIIEACRAEGRAALIGYLPVGFPSVAGSIEAMELLVRAGVDIVEIGVPYSDPVMDG
PVIQDAAVRALEGGVRLADTFAAVRAVRAAGAGALVMTYWNPVLRYGVDRFAADLAAAGG
DGLITPDLIPDEAADWIGAADEHGLDKVFLVAPSSTPERLAAVTSRSRGFVYATAVMGVT
GARSSVGDAAEDLVVRTRAVTDLPICVGLGVSTGEQASQVGRFADGVIVGSALVRCLTEA
STPASGLMALEELVRDLAAGVRRGRS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcagcccgatcatcgaggcctgccgggccgaagggcgtgcggccctcatcggc
tacctgcccgtcggcttcccgtccgtcgccggctccatcgaggcgatggagctgctggtc
cgggccggggtggacatcgtcgagatcggcgtgccctacagcgaccccgtgatggacggc
ccggtcatccaggacgccgccgttcgtgccctcgagggaggggtccgcctggcggacacc
ttcgccgcggtccgcgccgtgcgtgccgcgggcgctggagccctcgtgatgacctactgg
aacccggtgctgcgctacggcgtggaccgcttcgccgccgatctcgcggcggccggcggc
gacggcctcatcacccccgacctcatccccgacgaggcagcggactggatcggcgcggcg
gacgagcacggcctcgacaaggtgttcctcgtcgccccgagctcgacgccggagcggctg
gccgcagtgacgtcacggtcccgcggcttcgtctacgcgacggccgtcatgggcgtcacc
ggggcccggtcgagcgtcggggacgcggccgaggacctcgtcgtccgcacgagggccgtc
acggacctaccgatctgtgtcggcctcggtgtgtccaccggcgaacaggcgagtcaggtg
ggtcggttcgcggacggtgtcatcgtcgggtcggcgctcgtccggtgcctcaccgaggcg
tcgacccccgcatcagggctcatggcactcgaggagctcgtgcgcgacctcgccgcgggc
gtccggaggggacggtcgtga

DBGET integrated database retrieval system