KEGG   Intrasporangium calvum: Intca_1642Help
Entry
Intca_1642        CDS       T01385                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ica  Intrasporangium calvum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Intca_1642
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Intca_1642
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Intca_1642
Enzymes [BR:ica01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Intca_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1852816..1853616
Genome map
AA seq 266 aa AA seqDB search
MSVSPIIEACRAEGRAALIGYLPVGFPSVAGSIEAMELLVRAGVDIVEIGVPYSDPVMDG
PVIQDAAVRALEGGVRLADTFAAVRAVRAAGAGALVMTYWNPVLRYGVDRFAADLAAAGG
DGLITPDLIPDEAADWIGAADEHGLDKVFLVAPSSTPERLAAVTSRSRGFVYATAVMGVT
GARSSVGDAAEDLVVRTRAVTDLPICVGLGVSTGEQASQVGRFADGVIVGSALVRCLTEA
STPASGLMALEELVRDLAAGVRRGRS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcagcccgatcatcgaggcctgccgggccgaagggcgtgcggccctcatcggc
tacctgcccgtcggcttcccgtccgtcgccggctccatcgaggcgatggagctgctggtc
cgggccggggtggacatcgtcgagatcggcgtgccctacagcgaccccgtgatggacggc
ccggtcatccaggacgccgccgttcgtgccctcgagggaggggtccgcctggcggacacc
ttcgccgcggtccgcgccgtgcgtgccgcgggcgctggagccctcgtgatgacctactgg
aacccggtgctgcgctacggcgtggaccgcttcgccgccgatctcgcggcggccggcggc
gacggcctcatcacccccgacctcatccccgacgaggcagcggactggatcggcgcggcg
gacgagcacggcctcgacaaggtgttcctcgtcgccccgagctcgacgccggagcggctg
gccgcagtgacgtcacggtcccgcggcttcgtctacgcgacggccgtcatgggcgtcacc
ggggcccggtcgagcgtcggggacgcggccgaggacctcgtcgtccgcacgagggccgtc
acggacctaccgatctgtgtcggcctcggtgtgtccaccggcgaacaggcgagtcaggtg
ggtcggttcgcggacggtgtcatcgtcgggtcggcgctcgtccggtgcctcaccgaggcg
tcgacccccgcatcagggctcatggcactcgaggagctcgtgcgcgacctcgccgcgggc
gtccggaggggacggtcgtga

DBGET integrated database retrieval system