KEGG   Intrasporangium calvum: Intca_1686Help
Entry
Intca_1686        CDS       T01385                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ica  Intrasporangium calvum
Pathway
ica00010  Glycolysis / Gluconeogenesis
ica00051  Fructose and mannose metabolism
ica00562  Inositol phosphate metabolism
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01120  Microbial metabolism in diverse environments
ica01130  Biosynthesis of antibiotics
ica01200  Carbon metabolism
ica01230  Biosynthesis of amino acids
Module
ica_M00002  Glycolysis, core module involving three-carbon compounds
ica_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Intca_1686
   00051 Fructose and mannose metabolism
    Intca_1686
   00562 Inositol phosphate metabolism
    Intca_1686
Enzymes [BR:ica01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Intca_1686
Exosome [BR:ica04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Intca_1686
  Exosomal proteins of bladder cancer cells
   Intca_1686
  Exosomal proteins of melanoma cells
   Intca_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU48199
UniProt: E6S9K3
Position
1913459..1914268
Genome map
AA seq 269 aa AA seqDB search
MATSKTVGRVPLMAGNWKMNLDHLQATHLIQKLDWTLRDAKHDYDGVEVAVLPPFTDLRS
VQTLVEGDRLHLRYGAQDLSPHASGAYTGDISGAFLKKLGCTYVVVGHSERREGHHETDD
VVAAKVQAAYRHGLTPILCCGEGLEVRKEGSQVEHVVAQLRAALDGVTREQAASIVIAYE
PIWAIGTGEVATPDDAQEVCAAIRTLLAELYSGDLADGVRILYGGSVKAANVAAIMAQED
VDGALVGGASIDPAEFASICRYRDHLTAG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggccacctccaagactgtcggtcgggtgcccctcatggccggcaactggaagatgaac
ctcgaccatctgcaggccacccacctcatccagaagctcgactggacgctccgggacgcc
aagcacgactacgacggcgtcgaggtcgcggtcctgcctcccttcaccgacctgcgctcg
gtccagaccctcgtcgagggtgatcggctgcacctgcgctacggcgctcaggacctgtcc
ccccacgcgtccggggcctacaccggtgacatctccggggcgttcctcaagaagctcggc
tgcacctacgtcgtcgtcggccacagcgagcgtcgggaggggcaccacgagaccgacgac
gtcgtggcggccaaggtccaggcggcctaccggcacggcctcacgcccatcctgtgctgc
ggcgagggcctcgaggtccgcaaggagggcagccaggtcgagcacgtcgtcgcccagctg
cgggcggccctcgacggggtgacccgagagcaggccgcgagcatcgtcatcgcctacgag
ccgatctgggccatcgggaccggtgaggtcgcgacccccgacgacgcccaggaggtctgc
gccgcgatccggaccctgctcgccgagctctacagcggcgacctcgccgacggcgtgcgg
atcctctacggcggaagcgtcaaggcggccaacgtcgccgccatcatggcccaggaggac
gtcgacggcgccctcgtcggtggggcgtccatcgaccccgccgagttcgcgtcgatctgc
cgctaccgcgaccacctgacggcgggctga

DBGET integrated database retrieval system