KEGG   Intrasporangium calvum: Intca_1686Help
Entry
Intca_1686        CDS       T01385                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ica  Intrasporangium calvum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Intca_1686
   01230 Biosynthesis of amino acids
    Intca_1686
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Intca_1686
   00051 Fructose and mannose metabolism
    Intca_1686
   00562 Inositol phosphate metabolism
    Intca_1686
Enzymes [BR:ica01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Intca_1686
Exosome [BR:ica04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Intca_1686
  Exosomal proteins of bladder cancer cells
   Intca_1686
  Exosomal proteins of melanoma cells
   Intca_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1913459..1914268
Genome map
AA seq 269 aa AA seqDB search
MATSKTVGRVPLMAGNWKMNLDHLQATHLIQKLDWTLRDAKHDYDGVEVAVLPPFTDLRS
VQTLVEGDRLHLRYGAQDLSPHASGAYTGDISGAFLKKLGCTYVVVGHSERREGHHETDD
VVAAKVQAAYRHGLTPILCCGEGLEVRKEGSQVEHVVAQLRAALDGVTREQAASIVIAYE
PIWAIGTGEVATPDDAQEVCAAIRTLLAELYSGDLADGVRILYGGSVKAANVAAIMAQED
VDGALVGGASIDPAEFASICRYRDHLTAG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggccacctccaagactgtcggtcgggtgcccctcatggccggcaactggaagatgaac
ctcgaccatctgcaggccacccacctcatccagaagctcgactggacgctccgggacgcc
aagcacgactacgacggcgtcgaggtcgcggtcctgcctcccttcaccgacctgcgctcg
gtccagaccctcgtcgagggtgatcggctgcacctgcgctacggcgctcaggacctgtcc
ccccacgcgtccggggcctacaccggtgacatctccggggcgttcctcaagaagctcggc
tgcacctacgtcgtcgtcggccacagcgagcgtcgggaggggcaccacgagaccgacgac
gtcgtggcggccaaggtccaggcggcctaccggcacggcctcacgcccatcctgtgctgc
ggcgagggcctcgaggtccgcaaggagggcagccaggtcgagcacgtcgtcgcccagctg
cgggcggccctcgacggggtgacccgagagcaggccgcgagcatcgtcatcgcctacgag
ccgatctgggccatcgggaccggtgaggtcgcgacccccgacgacgcccaggaggtctgc
gccgcgatccggaccctgctcgccgagctctacagcggcgacctcgccgacggcgtgcgg
atcctctacggcggaagcgtcaaggcggccaacgtcgccgccatcatggcccaggaggac
gtcgacggcgccctcgtcggtggggcgtccatcgaccccgccgagttcgcgtcgatctgc
cgctaccgcgaccacctgacggcgggctga

DBGET integrated database retrieval system