KEGG   Intrasporangium calvum: Intca_1856Help
Entry
Intca_1856        CDS       T01385                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ica  Intrasporangium calvum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ica00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Intca_1856
Enzymes [BR:ica01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Intca_1856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2090095..2090700)
Genome map
AA seq 201 aa AA seqDB search
MIASLSGTVLKAGLDSVVVAVGGVGMLVHTTPATAAALRIGQPADLATTLVVREDSLTLY
GFATEEEKHVFETVQTVSGVGPRLALAVLAVHDPTSVRRALGSGDIAALTKVPGIGKKGA
ERLVLELRDKLGALAGSSDGASIGHQRMDGEPWREQVREALVGLGWTVRQADDALDRVAP
QAADGASVSAMLRAALRELGR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcgctgtccggaaccgtcctcaaggcaggcctcgactcggtcgtcgtggcc
gtgggtggggtgggcatgctcgtccacacgacaccggccaccgccgccgcgctgcggatc
ggccagcccgccgacctcgccacgacgctcgtggtgcgggaggactccctgacgctctac
gggttcgcgacggaggaggagaagcacgtcttcgagacggtgcagacggtctccggggtc
gggccccgcctggccctggcggtgctcgcagtgcacgaccccacgtccgtgcgccgggcc
ctgggctcgggcgacatcgcggccctgaccaaggtgccggggatcggcaagaagggcgcc
gagcggctcgtcctcgagctgcgcgacaagctcggcgcgctcgccgggtcgagcgacggc
gcgagcatcgggcaccagcgcatggacggcgagccgtggcgcgagcaggtccgcgaggcc
ctggtcggcctcggctggacggtgcggcaggccgacgacgccctcgaccgggtcgccccc
caggccgccgacggggccagcgtctccgcgatgctgcgggcggcgctgcgcgagctgggc
cgatga

DBGET integrated database retrieval system