KEGG   Intrasporangium calvum: Intca_1916Help
Entry
Intca_1916        CDS       T01385                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ica  Intrasporangium calvum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ica00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ica00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2154547..2156076
Genome map
AA seq 509 aa AA seqDB search
MSESYLTRIGGLIRDARRHKAMTQAELAELLGTSQGAVTRIEAGKQNLSLDMLAKIGDAL
DSEFVSVGHSGPQHLRIVGGKQLSGSIDVKTSKNAAVALLCGSLLNRGRTTLRSLARIEE
VNRILEVLSSIGVRTRWLPDSNDLEIIPPAQLHLEDIDVAAARRTRTVIMFLGPLLHEHP
NFQLPYAGGCDLGTRTVEPHLAALRHFGLEVTATHGFYEARSDRSVNPSRAIVLTERGDT
VTENVLMAAARHDGRTVIRNASPNYMVQDLCFFLEKLGVRIEGIGSTTLVVHGRSQIDVD
VDYSPSEDPIEAMSLLAAAVVTDSRITIRRVPIEFLEIELATLEEMGMKYDLSSEYTSAN
GKTRLVDLTTIPGPLRAPTDKIHPMPFPGLNIDNLPFFALIGAVAEGSTMIHDWVYENRA
IYLTELTKVGARVQLLDPHRVMIEGPTRWRAAEVVCPPALRPGVVVLLAMLAAPGTSVLR
NVYVINRGYEDLAERLNALGATIEVFRDI
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgaaagctacctcacccgaatcggcggcctcatccgcgacgcccgccgccacaag
gcgatgacccaggcggagctcgccgagctcctggggacctcgcaaggtgccgtcacacgg
atcgaggccggcaagcagaacctcagcctcgacatgctggccaagatcggtgatgccctc
gactccgagttcgtctccgtcgggcactccgggccacagcacctgcgcatcgtcgggggc
aagcagctctccggctccatcgacgtcaagacctcgaagaacgcggccgtcgccctgctc
tgcggctccctgctcaaccggggccggacgaccctgcggagcctcgcccggatcgaggag
gtcaaccggatcctcgaggtgctctcctcgatcggcgtccggacccgctggctgcccgac
agcaacgacctggagatcatccccccggcgcagctgcacctcgaggacatcgatgtcgcc
gccgcgcggcgcacccgcacggtcatcatgttcctcgggccgctgctgcacgagcacccg
aacttccagctcccctacgccggtggctgcgacctcggcacccgcacggtcgagccccac
ctcgcggcgcttcggcacttcggcctcgaggtgaccgcgacgcacggcttctacgaggcg
cggtccgaccgctcggtcaacccgagccgagccatcgtgctgacggagcggggcgacacg
gtcaccgagaacgtcctcatggccgccgcccgccatgacggacgcaccgtgatccgcaac
gcgtcccccaactacatggtccaggacctgtgcttcttcctcgagaagctcggggtccgg
atcgagggcatcggctcgaccacgttggtcgtccacggcaggtcgcagatcgacgtcgac
gtcgactactcgcccagcgaggaccccatcgaggcgatgagcctgctcgcggccgccgtc
gtcacggactcgcgcatcaccatccgccgcgtgccgatcgagttcctcgagatcgagctg
gcgaccctcgaggagatggggatgaagtacgacctcagctccgagtacacctccgcgaac
ggcaagacgcggctcgtggacctgaccacgatcccgggtcccctgagggcgccgaccgac
aagatccacccgatgcccttcccggggctcaacatcgacaacctgcccttcttcgcgctc
atcggcgccgtggctgagggcagcaccatgatccacgactgggtctacgagaaccgggca
atctacctgaccgagctgaccaaggtcggcgcgcgggtgcagctgctcgacccgcaccgc
gtcatgatcgagggcccgacccggtggcgggctgccgaggtcgtctgcccgccggcactg
cgccccggtgtcgtcgtcctcctcgccatgctcgccgcacccggcacgtccgtcctgcgc
aatgtgtacgtcatcaaccgcggctacgaggacctcgcggagcgcctcaacgcgctcggc
gcgacgatcgaggtgttccgcgacatctga

DBGET integrated database retrieval system