KEGG   Intrasporangium calvum: Intca_1917Help
Entry
Intca_1917        CDS       T01385                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ica  Intrasporangium calvum
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Intca_1917
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Intca_1917
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Intca_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2156200..2157033
Genome map
AA seq 277 aa AA seqDB search
MPDARNDARDDESGPRPARGTTDDAVATNPVDLTGRTALVTGAASGIGAAIARALSRAGA
TVHAVDRDDAGLTALAEEATLTTVVADLADLDALADLPTDVDILVNNAGIQHVSPIEEFP
LDRFDFILDLMLVSPFRLIRQSLPHMYAGGWGRVINISSVHGLRASPFKSAYVTAKHGLE
GLSKVVALEGAPHGVTSVCINPAYVRTPLVETQIADQARTHGIPESEVIEKIMLSPVAVK
RLVEPAEVAALALFLCGPAAASVTGTSFVMDGGWTAH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgcccgcaacgatgcccgcgacgacgagtccgggccccgccccgcacgcggg
accacggacgacgcggtggcgaccaacccggtggacctcaccggccgtacggcgctcgtc
acgggggccgcgagcgggatcggggcagccatcgcccgagccctgagccgggccggcgcg
accgtccatgccgtcgaccgcgacgacgccgggctcaccgccctcgcggaggaggcgacg
ctgacgacggtcgtcgcggacctggccgacctcgacgccctggccgacctgccgacggac
gtggacatcctcgtcaacaacgcgggcatccagcacgtgagcccgatcgaggagttcccg
ctcgaccggttcgacttcatcctcgacctcatgctcgtgtcacccttccgcctcatccgc
cagtcgctgccgcacatgtatgccggcggttggggacgggtcatcaacatctcgagcgtg
cacggcctccgggcgagccccttcaagtcggcctacgtcaccgccaagcacgggctggag
ggactctcgaaggtggtcgccctggaaggcgcaccgcacggggtgacgtccgtgtgcatc
aacccggcctatgtgcgcacccctctcgtcgagacccagatcgccgaccaggcccgcacc
cacggcatccccgagagcgaggtcatcgagaagatcatgctctcgccggtcgctgtcaag
cggctcgtcgagccggccgaggtcgccgccctcgccctgttcctctgcggccccgccgcc
gcgtcggtcaccgggacgtccttcgtcatggacggcggctggactgcccactga

DBGET integrated database retrieval system