KEGG   Intrasporangium calvum: Intca_2003Help
Entry
Intca_2003        CDS       T01385                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ica  Intrasporangium calvum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2247594..2248169
Genome map
AA seq 191 aa AA seqDB search
MGVRLTRDAVRRALDAVPREGFLPASARTAAGRDAPIPIGHGQTNSQPRTVETMLRLLDV
QPGQRVLDVGSGSGWTTALLAHLTGPDGWVRGVELVPELAQWGAENLAATSLTWASISPV
VDDVLGDPEHGPYDRILVSANARSLPDELVEQLADGGRMVIPVNSRMVVVERRGGEARTS
EHGAYRFVPLR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgggggtgcgcctgacccgcgatgccgtgcggcgggctctcgacgcggtcccgcgtgag
ggcttcctcccggcgtccgcccggaccgctgccggtcgggacgcccccatcccgatcggg
cacggacagaccaactcccagccccggacggtcgagacgatgctgcggctcctcgacgtc
cagcccgggcagcgggtcctcgacgtggggtcgggctcggggtggaccaccgctctcctc
gcccacctcaccggcccggacggatgggtccggggcgtcgagctcgtccccgagctcgcc
cagtggggcgcggagaacctcgccgcgaccagcctgacctgggcttccatctcacccgtc
gtcgacgacgtcctcggcgatcccgagcacgggccctacgaccggatcctcgtctccgcc
aacgcgcgttcactgccggacgagctcgtcgagcagctggccgacggcgggcgcatggtc
atccccgtgaacagccggatggtcgtggtcgagcgccggggaggcgaggcccgcaccagc
gagcacggggcctaccgcttcgtcccgctgcgctga

DBGET integrated database retrieval system