KEGG   Intrasporangium calvum: Intca_2018Help
Entry
Intca_2018        CDS       T01385                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ica  Intrasporangium calvum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Intca_2018
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Intca_2018
  Amino acid metabolism
   00310 Lysine degradation
    Intca_2018
Enzymes [BR:ica01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Intca_2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2261710..2263554
Genome map
AA seq 614 aa AA seqDB search
MSERVTMPALGESVTEGTVTRWLKNVGDRVEVDEPLLEVSTDKVDTEIPSPVAGTLQEIL
VQEDDTVPVGADLAVIGEGAAAADEPAPAAEQPAEAKQPAAEEAPAATAAPAPEAPSTEQ
EPQPATSEPEAEQAQQPQAAASPAGGGEGQTVTMPALGESVTEGTVTRWLKAEGDDVAVD
EPLLEVSTDKVDTEIPSPIAGTLTKILVGEDETVPVGGDLAIIGGSAPAEAEAPAAPAEP
EAPAAPAEAEAPAAPAEAPAAPAQPEAPAQPEAPAAPEAPAEAPAAPATPAAATSDSSDA
AAYVTPLVRKLAAQNGIDLSTLKGTGVGGRIRKQDVLDAAQAAQAAQAAQEPAAPEAPAP
APAAAEAPAAAPAAAAAVSPKRGTREKMTRLRKIIATRMVESLQVSAQLTTVVEVDLTKV
ARIRDRVKKDFEAREGTKLSFLPFLALAATEALKAHPMVNASVEGDEVVYHGTENLSIAV
DTDKGLMVPVVKNVGDLNIAGLARAIADLADRTRNNKVTPDDLSGGTFTITNTGSRGALF
DTPIINQPQVAILGTGTIVKRPVVVTDADGGETIAIRSMMYLALSYDHRIVDGADAARFL
GTMKARLEEGHFEA
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacgcgtgaccatgccggccctgggtgagtcagtcaccgaagggaccgtcacc
cgctggctgaagaacgtcggcgatcgcgtcgaggtggacgagcccctgctcgaggtctcg
acggacaaggtcgacaccgagatcccctctcccgtcgccgggaccctccaggagatcctc
gtccaggaggacgacaccgtcccggtcggggccgacctcgccgtgatcggcgaaggcgcc
gcagccgccgacgagcctgcaccggccgccgagcagcccgccgaggcgaagcagcccgca
gccgaggaggcgccagcagcgaccgccgcgcccgcacccgaggcccccagtaccgagcag
gagccgcaaccggccacgagcgagcccgaggccgagcaggcccagcagccgcaggccgcg
gcctcgccggccggaggtggcgagggccagaccgtgacgatgcctgccctgggcgagtcg
gtcaccgaaggaaccgtcacccggtggctcaaggccgagggcgacgacgtggccgtcgac
gagcccctcctcgaggtctcgaccgacaaggtcgacaccgagatcccctctccgatcgcc
ggcaccctgacgaagatccttgtcggcgaggatgagaccgttccggtcgggggcgacctc
gccatcatcggcggatccgcgccggctgaggctgaggcccctgccgcaccggccgagccc
gaggcccctgccgcaccggccgaggctgaggcccctgccgcaccggccgaggcgccagct
gcacccgcccagcccgaggcaccagcccagccggaggcaccagcagcacccgaggcaccg
gccgaggcgccagctgcacctgccacgcccgcagccgcgacgagcgactcctcggatgcg
gctgcctacgtgacccccctggtgcgcaagctcgctgcccagaacgggatcgacctgtcg
acgctcaagggaaccggagtgggtggccggattcgcaagcaggacgtcctcgacgcggcg
caggccgcgcaggccgctcaggccgcgcaggagccggccgcgccggaggcaccggctccc
gctcccgccgcggccgaagccccggcggcagcacccgcggcggctgcggccgtgtcgccg
aagcgcggcacccgagagaagatgacgcgactgcggaagatcatcgcgacgcgcatggtc
gagtcgctccaggtctccgcccagctcacgaccgtcgtcgaggtggacctcaccaaggtc
gcgcggatccgggaccgggtgaagaaggacttcgaggcccgcgagggcacgaagctcagc
ttcctgcccttcctcgccctggctgcgaccgaggcgctcaaggcccacccgatggtcaac
gcgagcgtcgagggcgacgaggtggtctaccacgggaccgagaacctctcgatcgccgtg
gacaccgacaagggcctcatggtcccggtcgtcaagaacgtgggcgatctcaacatcgcc
ggactggcccgcgccatcgccgacctggccgaccggacccgcaacaacaaggtcactccc
gacgacctgtccggtggcacgttcacgatcaccaacaccggcagccgcggcgcgctcttc
gacacgccgatcatcaaccagccgcaggtggccatcctcggcaccggcacgatcgtcaag
cgacccgtcgtcgtcaccgacgctgatggcggcgagacgatcgcgatccgctcgatgatg
tatctcgcgctgtcctacgaccaccggatcgtggacggcgccgatgcggcccgcttcctc
ggcacgatgaaggcgcggctcgaagagggccacttcgaggcctga

DBGET integrated database retrieval system