KEGG   Intrasporangium calvum: Intca_2018Help
Entry
Intca_2018        CDS       T01385                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ica  Intrasporangium calvum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Intca_2018
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Intca_2018
  Amino acid metabolism
   00310 Lysine degradation
    Intca_2018
Enzymes [BR:ica01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Intca_2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2261710..2263554
Genome map
AA seq 614 aa AA seqDB search
MSERVTMPALGESVTEGTVTRWLKNVGDRVEVDEPLLEVSTDKVDTEIPSPVAGTLQEIL
VQEDDTVPVGADLAVIGEGAAAADEPAPAAEQPAEAKQPAAEEAPAATAAPAPEAPSTEQ
EPQPATSEPEAEQAQQPQAAASPAGGGEGQTVTMPALGESVTEGTVTRWLKAEGDDVAVD
EPLLEVSTDKVDTEIPSPIAGTLTKILVGEDETVPVGGDLAIIGGSAPAEAEAPAAPAEP
EAPAAPAEAEAPAAPAEAPAAPAQPEAPAQPEAPAAPEAPAEAPAAPATPAAATSDSSDA
AAYVTPLVRKLAAQNGIDLSTLKGTGVGGRIRKQDVLDAAQAAQAAQAAQEPAAPEAPAP
APAAAEAPAAAPAAAAAVSPKRGTREKMTRLRKIIATRMVESLQVSAQLTTVVEVDLTKV
ARIRDRVKKDFEAREGTKLSFLPFLALAATEALKAHPMVNASVEGDEVVYHGTENLSIAV
DTDKGLMVPVVKNVGDLNIAGLARAIADLADRTRNNKVTPDDLSGGTFTITNTGSRGALF
DTPIINQPQVAILGTGTIVKRPVVVTDADGGETIAIRSMMYLALSYDHRIVDGADAARFL
GTMKARLEEGHFEA
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacgcgtgaccatgccggccctgggtgagtcagtcaccgaagggaccgtcacc
cgctggctgaagaacgtcggcgatcgcgtcgaggtggacgagcccctgctcgaggtctcg
acggacaaggtcgacaccgagatcccctctcccgtcgccgggaccctccaggagatcctc
gtccaggaggacgacaccgtcccggtcggggccgacctcgccgtgatcggcgaaggcgcc
gcagccgccgacgagcctgcaccggccgccgagcagcccgccgaggcgaagcagcccgca
gccgaggaggcgccagcagcgaccgccgcgcccgcacccgaggcccccagtaccgagcag
gagccgcaaccggccacgagcgagcccgaggccgagcaggcccagcagccgcaggccgcg
gcctcgccggccggaggtggcgagggccagaccgtgacgatgcctgccctgggcgagtcg
gtcaccgaaggaaccgtcacccggtggctcaaggccgagggcgacgacgtggccgtcgac
gagcccctcctcgaggtctcgaccgacaaggtcgacaccgagatcccctctccgatcgcc
ggcaccctgacgaagatccttgtcggcgaggatgagaccgttccggtcgggggcgacctc
gccatcatcggcggatccgcgccggctgaggctgaggcccctgccgcaccggccgagccc
gaggcccctgccgcaccggccgaggctgaggcccctgccgcaccggccgaggcgccagct
gcacccgcccagcccgaggcaccagcccagccggaggcaccagcagcacccgaggcaccg
gccgaggcgccagctgcacctgccacgcccgcagccgcgacgagcgactcctcggatgcg
gctgcctacgtgacccccctggtgcgcaagctcgctgcccagaacgggatcgacctgtcg
acgctcaagggaaccggagtgggtggccggattcgcaagcaggacgtcctcgacgcggcg
caggccgcgcaggccgctcaggccgcgcaggagccggccgcgccggaggcaccggctccc
gctcccgccgcggccgaagccccggcggcagcacccgcggcggctgcggccgtgtcgccg
aagcgcggcacccgagagaagatgacgcgactgcggaagatcatcgcgacgcgcatggtc
gagtcgctccaggtctccgcccagctcacgaccgtcgtcgaggtggacctcaccaaggtc
gcgcggatccgggaccgggtgaagaaggacttcgaggcccgcgagggcacgaagctcagc
ttcctgcccttcctcgccctggctgcgaccgaggcgctcaaggcccacccgatggtcaac
gcgagcgtcgagggcgacgaggtggtctaccacgggaccgagaacctctcgatcgccgtg
gacaccgacaagggcctcatggtcccggtcgtcaagaacgtgggcgatctcaacatcgcc
ggactggcccgcgccatcgccgacctggccgaccggacccgcaacaacaaggtcactccc
gacgacctgtccggtggcacgttcacgatcaccaacaccggcagccgcggcgcgctcttc
gacacgccgatcatcaaccagccgcaggtggccatcctcggcaccggcacgatcgtcaag
cgacccgtcgtcgtcaccgacgctgatggcggcgagacgatcgcgatccgctcgatgatg
tatctcgcgctgtcctacgaccaccggatcgtggacggcgccgatgcggcccgcttcctc
ggcacgatgaaggcgcggctcgaagagggccacttcgaggcctga

DBGET integrated database retrieval system