KEGG   Intrasporangium calvum: Intca_2199Help
Entry
Intca_2199        CDS       T01385                                 

Definition
formate dehydrogenase subunit gamma
Orthology
K00127  
formate dehydrogenase subunit gamma
Organism
ica  Intrasporangium calvum
Pathway
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Intca_2199
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Intca_2199
  Energy metabolism
   00680 Methane metabolism
    Intca_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2453636..2454109
Genome map
AA seq 157 aa AA seqDB search
MTHATSPSSGLDLRRSETVRRLAEQHATDRGALMVVLHAAVAELGHLERTDVETIADVLN
LSVADVHGVVSFYKDFRTDPAPAHTVHLCRGEACQAVGAESVFAQARAQLAHRDDVEVDE
VFCLGNCALGPSAMVDGRLHGRLSGERLLGLTEEWVR
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacgcgacgagcccgagcagcgggctggacctccgacggagcgagacggtgcgc
cggctcgccgagcagcacgcgacggaccgcggggccctgatggtcgtgctgcacgcggcc
gtggccgagctcggccacctcgagcggaccgacgtcgagaccatcgccgacgtgctcaac
ctgtcggtcgccgacgtccacggcgtcgtgtcgttctacaaggacttccgcacggatccg
gcgccggcgcacaccgtgcacctctgtcggggcgaggcctgccaggccgtcggcgccgag
tcggtcttcgcacaggcccgcgcgcagctcgcccaccgggacgacgtcgaggtcgacgag
gtgttctgcctcggcaactgcgccctcggaccttccgccatggtcgacgggcggctccac
ggacggctgtccggcgagcgcctcctcggcctcaccgaggagtgggtccgatga

DBGET integrated database retrieval system