KEGG   Intrasporangium calvum: Intca_2243Help
Entry
Intca_2243        CDS       T01385                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ica  Intrasporangium calvum
Pathway
ica00900  Terpenoid backbone biosynthesis
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01130  Biosynthesis of antibiotics
Module
ica_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Intca_2243
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Intca_2243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: ADU48752
UniProt: E6SEA4
Position
complement(2507458..2508702)
Genome map
AA seq 414 aa AA seqDB search
MTAAVPTPASPRRVILLGSTGSIGTQAIDLVQRNRDRFVVVGLSAGSNVQLLAEQAVALR
VPVVAAAGATPDVLAAAIRQAADRTEPGTASGGGAPGSPAAYDPELLTGPGASAALAARR
GDVVVNGITGAIGLEPTLAALRAGTTLALANKESLIIGGPLVKALAAPGQIVPVDSEHSA
IAQCLRGGRPEEVRRLVVTASGGPFRGRTRAELADVTPEQALAHPNFAMGRVITTNSATL
VNKGLEVIEAHLLFDIPFDRIDVVVHPQQMIHSMVEFVDGSTIAQAGPPRMLVPIALGMS
WPERLADADVPVDWTQAQSWEFEPLDDEAFPAVALARRVGEAGGTWPAVYNAANEVAVDA
FHEGRVSFVGIVDTVAAVVDSYAAEPGSSVTDLTLDDVLAADAWARHAARLRLS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctgccgtaccgactcctgcctccccccgccgggtgatcctgctcgggtccacc
ggctcgatcggcacccaggccatcgacctggtccagcgcaaccgcgaccggttcgtggtg
gtcggcctctctgcgggcagcaacgtccagctcctcgccgagcaggccgtggccctccgc
gtccccgtcgtcgccgcggccggggccacgccggacgtgctcgcagccgcgatccggcag
gccgccgaccggaccgagccgggcaccgcatccggcgggggagcgccagggagcccagcg
gcatacgacccggagctgttgaccgggcccggcgccagcgcagcgctggccgcccggcgg
ggtgatgtcgtcgtcaacggcatcaccggcgcgatcgggctcgagccgaccctggcagcc
ctgcgcgccgggacgacgctcgcgctggccaacaaggagtcgctcatcatcggcggcccg
ctcgtcaaggcgctcgccgctccggggcagatcgtgcccgtcgacagcgagcactcggcg
atcgctcagtgcctgcgtggggggcgtccggaggaggtccggcggctcgtcgtcaccgcg
agcggcggaccgttccgcgggcgcacccgggccgagctcgccgacgtcacgccggagcag
gccctcgcccacccgaacttcgcgatgggtcgggtcatcacgacgaactccgccaccctc
gtcaacaagggtctcgaggtgattgaggcgcacctgctcttcgacatcccgttcgaccgg
atcgacgtcgtcgtgcacccgcagcagatgatccattcgatggtcgagttcgtcgacggt
tcgacgatcgcgcaggccggaccgccacggatgctcgtcccgatcgcgctcggcatgtcg
tggcccgagcggctcgccgacgccgacgtgccggtcgactggacccaggcgcagtcgtgg
gagttcgagccgctcgatgacgaggcgttcccggcggtggccctcgcgcgccgagtcggg
gaggccgggggcacctggccggcggtgtacaacgcggccaacgaggtggctgtggacgcc
ttccacgagggccgggtgagcttcgtcggcatcgtcgacaccgtcgcggccgtggtggat
tcgtatgccgctgagcccggctccagcgtcaccgacctcacgctcgacgacgtcctcgcc
gccgatgcctgggcccgccacgctgcccggctgcgactctcctga

DBGET integrated database retrieval system