KEGG   Intrasporangium calvum: Intca_2402Help
Entry
Intca_2402        CDS       T01385                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ica  Intrasporangium calvum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ica00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2688316..2690688
Genome map
AA seq 790 aa AA seqDB search
MSPEHPGRHHPTEPTEPGDPTDPTDPADPTDPGPELDDAAIDAFLHGRNGQPHDLLGHHV
GPGGLTITCYRPFAHSVLARLDTGAEVDLQHVRDGIWSMTSPHFGTTHDYRLLVTYDDGV
EHEQDDPYRFAPTLGEIDRHLINEGRHEQLWTVLGAHVRHYPGPMGDVWGVSFALWAPRA
KAVHVIGDFNGWDRLSHPMRALGSSGLWELFLPGAQEGMNYQFAVRGADDVVRLKSDPMA
RMTEVAPKQAAIVTRSHHTWHDEEWMERRRTTDPHVGPMSVYEVHVGSWRQGLGYRGLAE
HLVNYVRDAGFTHVEFLPVMEHPYVPSWGYHVTGYYAPSSRWGTPDDFRHLVDQLHQAGI
GVILDWVPGHFATDDWALARFDGEALYEHPDKRLGWHPEWGSNIFDYGRPEVRNFLVANA
IYWLEEFHADGLRVDGVASMLYLDYARKAGEWVPNRHGGRENLEAVALLQETNATAYKRL
GGIVTVAEESTSWPGVTKPTDQDGLGFGFKWNMGWMNDSLSYLGQDPVYRSHHHGKLTFS
LMYAYTENFVLPISHDEVVHGKGSLLRKSRGSREDQVATLRAFLAYLWSHPGKQLLFMGC
EFGQESEWSEGRSLDWWLLDQPLHYRVHNLVKDLNGIYRANPALWALDSHPAGFQWLEAD
DADHNTLAWLRLGAGDPAVDAPVVACVVNFSGETLEGYRVGLPRGGTWRVVLDTSGYHPG
APSSTGVVVEARPEAWQGQEHAAMVTVPRLSAVWLIPEEPPAAPHPEALPAEAAATAETP
EATGHEGSTP
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggaacacccaggcaggcaccacccgaccgagccgaccgagccgggcgacccg
accgacccgaccgacccggccgacccgaccgacccggggccggagctggacgacgccgcc
atcgacgccttcctgcacggccgcaacggccagccccatgacctgctcggccaccacgtc
gggcccggcgggctgacgatcacctgctaccggccgttcgcccactccgtcctggcccgg
ctggacacgggcgccgaggtcgacctgcagcacgtgcgtgacggcatctggtcgatgacc
tcgccgcacttcggcacgacccacgactaccgcctcctcgtgacgtacgacgacggggtc
gagcacgagcaggacgacccctaccggttcgccccgacgctgggcgagatcgaccggcac
ctgatcaacgagggccgccacgagcagctgtggacggtgctcggcgcccacgtccgccac
tatcccggcccgatgggcgacgtgtggggcgtctcgttcgcactgtgggcgccgcgcgcc
aaggcagtgcacgtcatcggcgacttcaacggctgggaccggctctcccacccgatgcgg
gcgctcggctcgagcggtctctgggagctgttcctccccggcgcgcaggaggggatgaac
taccagttcgcggtccggggcgcggacgacgtcgtccggctcaagagcgacccgatggcc
cggatgaccgaggtggctccgaagcaggcggcgatcgtcacccgctcgcaccacacctgg
cacgacgaagagtggatggagcggcgccggaccacggatccccacgtggggccgatgagc
gtctacgaggtccacgtcggttcgtggcgccagggcctgggctaccgggggctcgccgag
cacctcgtcaactacgtccgggacgccggcttcacccacgtggagttcctcccggtcatg
gagcacccctacgttccctcgtggggctaccacgtgaccgggtactacgcgccgagctca
cggtggggtacgcccgacgacttccgccacctcgtcgaccagctccaccaggccgggatc
ggggtcatcctcgactgggtcccgggccacttcgccacggacgactgggccctggcccgc
ttcgacggcgaagccctgtacgagcaccctgacaagcgcctcggctggcaccccgagtgg
ggctccaacatcttcgactacggccggcccgaggtgcgcaacttcctcgtcgccaatgcg
atctactggctcgaggagttccacgccgacggcctccgggtcgacggcgtcgcgtcgatg
ctctacctcgactacgcccgcaaggccggtgagtgggtccccaaccgccacggcggtcgg
gagaacctcgaggcggtcgccctgctgcaggagacgaacgccaccgcctacaagcggctc
ggggggatcgtcaccgtcgccgaggagtccacctcctggccgggcgtcaccaagcccacc
gaccaggacggtctcggcttcgggttcaagtggaacatgggctggatgaacgactccctg
agctacctcggccaggacccggtctaccgcagccaccaccacggcaagctgacgttctcg
ctcatgtacgcctacaccgagaacttcgtcctgccgatcagccatgacgaggtggtccac
ggcaagggctccctgctccgcaagtcacgcggctctcgtgaggaccaggtggccacgctg
cgcgccttcctcgcctacctctggagccaccccggcaaacagctgctcttcatgggctgt
gagttcggccaggagtccgagtggtccgagggccgcagcctcgactggtggctgctcgac
cagccgctgcactaccgcgtccacaacctcgtcaaggacctcaacgggatctaccgggcc
aacccggccctctgggcgctcgactcgcaccccgccgggttccagtggctcgaggccgac
gacgcggaccacaacaccttggcgtggctccggctgggcgccggcgaccctgccgtggac
gcgcccgtcgtggcgtgcgtcgtcaacttcagcggcgagacgctcgagggctaccgggtc
gggctgccccggggcggcacgtggcgcgtcgtgctcgacacgtcgggctaccaccccggc
gcgccgtcgagcaccggagtcgtcgtcgaggcgcggccagaggcctggcagggccaggag
cacgccgcgatggtcaccgtgccccggctctccgcggtgtggctcatcccggaggagcca
cctgcggccccccatcccgaagccctaccagcagaggcggccgcaacggccgagaccccc
gaagcgaccggacacgaaggaagcacaccatga

DBGET integrated database retrieval system