KEGG   Intrasporangium calvum: Intca_2452Help
Entry
Intca_2452        CDS       T01385                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ica  Intrasporangium calvum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Intca_2452
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Intca_2452
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Intca_2452
Enzymes [BR:ica01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Intca_2452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2742905..2743999)
Genome map
AA seq 364 aa AA seqDB search
MAHQWRGVIREYADRLPLLEGAPVVTLHEGGTPLIHAAKLSERVGAEVHLKYEGLNPTGS
FKDRGMTTAISVAAKHGARAVIAASTGNTSASAAAYATKAGMTCGVLVPEGKIAMGKLSQ
AIAHGATLLQVDGNFDDCLTLARKLAEAYPVELVNSVNPARIEGQKTAAFEIVDALGDAP
EIHCLPVGNAGNITAYWKGYREYSSDPAVSDQPGPASRLPRMWGFQAAGAAPLVLGHPVD
HPETIATAIRIGNPASWSQAIAARDESGGRIEAVTDAQILEAHRYLSAEEGVFVEPGSAA
SVAGLLASHAAGLVPAGARIVCTVTGHGLKDPQWALRTADGSEVVPTRIPLDAYTAAHAL
GLEG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctcaccagtggcgcggagtgatccgcgagtacgccgaccggttgccgctcctcgag
ggtgcgccggtggtgacgctccacgagggcggcacccccctcatccacgccgcgaagctg
tccgagcgcgtcggtgcggaggtccacctcaagtacgagggcctcaacccgaccgggtcg
ttcaaggaccgggggatgacgacggcgatcagcgtcgccgccaagcacggcgcgagggcg
gtgatcgcggccagcacgggcaacacgagcgcctccgctgcggcctacgccaccaaggcc
ggcatgacctgcggcgtcctcgtccccgagggcaagatcgcgatgggcaagctgagccag
gccatcgcccacggggccaccctcctgcaggtcgacggcaacttcgacgactgcctgacg
ctcgcgcgcaagcttgccgaggcctaccccgtcgagctggtcaactccgtcaaccccgcc
cggatcgaggggcagaagaccgccgcgttcgagatcgtcgacgcgttgggtgacgctccc
gagatccactgcctcccggtggggaacgccggcaacatcaccgcctactggaagggatac
cgcgagtactcctcggaccccgccgtgagcgaccagccgggtcccgcgtcgcggttgccg
cggatgtggggtttccaggccgcgggtgccgcgcctctggtcctcgggcacccggtcgac
cacccggagaccatcgccaccgccatccggatcggcaaccccgcctcgtggtcccaggcg
atcgccgcacgcgacgaatcgggtggccggatcgaggcggtcaccgacgcgcagatcctc
gaggcgcatcgctacctgtccgccgaggagggcgtcttcgtcgagccgggctcggccgcc
tcggtggccggcctcctcgcgagccacgccgcgggtctcgtccccgccggcgcccgcatc
gtctgcaccgtcaccggtcacgggctcaaggacccccagtgggcgctgcgcaccgccgac
ggttccgaggtggtgccgacgcggattcccctcgacgcctacaccgcggcgcacgccctc
gggctcgagggctga

DBGET integrated database retrieval system